From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001002000
  • symbol?:
  • description?: membrane spanning protein
  • strand?: -
  • coordinates?: 1270648..1271031
  • synteny block?: BlockID0005300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0167
    08BA02176:
    C248_0155
    11819-97:
    MS7_0160
    71193:
    ST398NM01_0180
    ECT-R 2:
    ECTR2_130
    ED133:
    SAOV_0113
    ED98:
    SAAV_0134
    HO 5096 0412:
    SAEMRSA15_01320
    JH1:
    SaurJH1_0157
    JH9:
    SaurJH9_0152
    JKD6008:
    SAA6008_00144
    JKD6159:
    SAA6159_00150
    LGA251:
    SARLGA251_01400
    M013:
    M013TW_0156
    MRSA252:
    SAR0168
    MSHR1132:
    SAMSHR1132_01400
    MSSA476:
    SAS0141
    Mu3:
    SAHV_0165
    Mu50:
    SAV0166
    MW2:
    MW0141
    RF122:
    SAB0107c
    ST398:
    SAPIG0180
    T0131:
    SAT0131_00157
    TCH60:
    HMPREF0772_10332
    TW20:
    SATW20_01770
    USA300_TCH1516:
    USA300HOU_0180
    VC40:
    SAVC_00600

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVE
    N315            MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVE
    NCTC8325        MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVE
    Newman          MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVE
    USA300_FPR3757  MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVE
                    ************************************************************

    COL             NFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMVIIQTAVLFTFVKTLPK
    N315            NFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMVIIQTAVLFTFVKTLPK
    NCTC8325        NFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMVIIQTAVLFTFVKTLPK
    Newman          NFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMVIIQTAVLFTFVKTLPK
    USA300_FPR3757  NFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMVIIQTAVLFTFVKTLPK
                    ************************************************************

    COL             SNHKIEE
    N315            SNHKIEE
    NCTC8325        SNHKIEE
    Newman          SNHKIEE
    USA300_FPR3757  SNHKIEE
                    *******