From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001009000
  • symbol?:
  • description?: alpha-helical coiled-coil protein

      descriptions from strain specific annotations:

    • alpha-helical coiled-coil protein
    • pANL51
    • short-chain dehydrogenase
    • SrpF
  • strand?: +
  • coordinates?: 1275405..1275917
  • synteny block?: BlockID0005370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0172
    08BA02176:
    C248_0160
    11819-97:
    MS7_0164 (srpF)
    71193:
    ST398NM01_0185
    ECT-R 2:
    ECTR2_134
    ED133:
    SAOV_0117
    ED98:
    SAAV_0138
    HO 5096 0412:
    SAEMRSA15_01360
    JH1:
    SaurJH1_0161
    JH9:
    SaurJH9_0156
    JKD6008:
    SAA6008_00148
    JKD6159:
    SAA6159_00154
    LGA251:
    SARLGA251_01440
    M013:
    M013TW_0160
    MRSA252:
    SAR0172
    MSHR1132:
    SAMSHR1132_01440
    MSSA476:
    SAS0146
    Mu3:
    SAHV_0170
    Mu50:
    SAV0171
    MW2:
    MW0145
    RF122:
    SAB0111
    ST398:
    SAPIG0185
    T0131:
    SAT0131_00161
    TCH60:
    HMPREF0772_10328
    TW20:
    SATW20_01810
    USA300_TCH1516:
    USA300HOU_0184
    VC40:
    SAVC_00620

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTLFLLEANNLDFASTKEELEAKAASLSTKTIPTLIEVQATENLTHGYFIVEANDEAEAK
    N315            MTLFLLEANNLDFASTKEELEAKAASLSTKTIPTLIEVQATENLTHGYFIVEANDEAEAK
    NCTC8325        MTLFLLEANNLDFASTKEELEAKAASLSTKTIPTLIEVQATENLTHGYFIVEANDEAEAK
    Newman          MTLFLLEANNLDFASTKEELEAKAASLSTKTIPTLIEVQATENLTHGYFIVEANDEAEAK
    USA300_FPR3757  MTLFLLEANNLDFASTKEELEAKAASLSTKTIPTLIEVQATENLTHGYFIVEANDEAEAK
                    ************************************************************

    COL             QFLTEADISIQLVKEVRLVGKDLDEVKNGDAHVDYLVTWNIPEGITMDQYLARKKKNSVH
    N315            QFLTEADISIQLVKEVRLVGKDLDEVKNGDAHVDYLVTWNIPEGITMDQYLARKKKNSVH
    NCTC8325        QFLTEADISIQLVKEVRLVGKDLDEVKNGDAHVDYLVTWNIPEGITMDQYLARKKKNSVH
    Newman          QFLTEADISIQLVKEVRLVGKDLDEVKNGDAHVDYLVTWNIPEGITMDQYLARKKKNSVH
    USA300_FPR3757  QFLTEADISIQLVKEVRLVGKDLDEVKNGDAHVDYLVTWNIPEGITMDQYLARKKKNSVH
                    ************************************************************

    COL             YEEVPEVEFKRTYVCEDMSKCICLYNAPDEEAVRRARKAVDTPIDGIEKL
    N315            YEEVPEVEFKRTYVCEDMSKCICLYNAPDEEAVRRARKAVDTPIDGIEKL
    NCTC8325        YEEVPEVEFKRTYVCEDMSKCICLYNAPDEEAVRRARKAVDTPIDGIEKL
    Newman          YEEVPEVEFKRTYVCEDMSKCICLYNAPDEEAVRRARKAVDTPIDGIEKL
    USA300_FPR3757  YEEVPEVEFKRTYVCEDMSKCICLYNAPDEEAVRRARKAVDTPIDGIEKL
                    **************************************************