From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001012000
  • symbol?: ssuC
  • description?: ABC transporter permease

      descriptions from strain specific annotations:

    • ABC transporter permease
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • ABC transporter, permease protein
    • ABC transporter ATP-binding protein
    • ABC transporter permease protein
    • binding--dependent transport system inner membrane component family protein
    • binding-protein-dependent transport system inner membrane component family protein
    • binding-protein-dependent transport system inner membrane protein
    • putative transport system permease
    • transport system permease
  • strand?: +
  • coordinates?: 1278008..1278769
  • synteny block?: BlockID0005400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0175
    08BA02176:
    C248_0163
    11819-97:
    MS7_0167
    71193:
    ST398NM01_0188
    ECT-R 2:
    ECTR2_137
    ED133:
    SAOV_0120
    ED98:
    SAAV_0141
    HO 5096 0412:
    SAEMRSA15_01390
    JH1:
    SaurJH1_0164
    JH9:
    SaurJH9_0159
    JKD6008:
    SAA6008_00151
    JKD6159:
    SAA6159_00157
    LGA251:
    SARLGA251_01470
    M013:
    M013TW_0163
    MRSA252:
    SAR0175
    MSHR1132:
    SAMSHR1132_01470
    MSSA476:
    SAS0149
    Mu3:
    SAHV_0173
    Mu50:
    SAV0174
    MW2:
    MW0148
    RF122:
    SAB0114
    ST398:
    SAPIG0188
    T0131:
    SAT0131_00164
    TCH60:
    HMPREF0772_10325
    TW20:
    SATW20_01840
    USA300_TCH1516:
    USA300HOU_0187
    VC40:
    SAVC_00635

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTRPTNNKFILPIITFIIFLGIWEMVIIIGHYQPVLLPGPALVGKSIWSFIVTGEIFQHL
    N315            MTRPTNNKFILPIITFIIFLGIWEMVIIIGHYQPVLLPGPALVGKSIWTFIVTGEIFQHL
    NCTC8325        MTRPTNNKFILPIITFIIFLGIWEMVIIIGHYQPVLLPGPALVGKSIWSFIVTGEIFQHL
    Newman          MTRPTNNKFILPIITFIIFLGIWEMVIIIGHYQPVLLPGPALVGKSIWSFIVTGEIFQHL
    USA300_FPR3757  MTRPTNNKFILPIITFIIFLGIWEMVIIIGHYQPVLLPGPALVGKSIWSFIVTGEIFQHL
                    ************************************************:***********

    COL             AISLWRFVAGFVVALLVAIPLGFLLGRNRWLYNAIEPLFQLIRPISPIAWAPFVVLWFGI
    N315            AISLWRFVAGFVVALLVAIPLGFLLGRNRWLYNAIEPLFQLIRPISPIAWAPFVVLWFGI
    NCTC8325        AISLWRFVAGFVVALLVAIPLGFLLGRNRWLYNAIEPLFQLIRPISPIAWAPFVVLWFGI
    Newman          AISLWRFVAGFVVALLVAIPLGFLLGRNRWLYNAIEPLFQLIRPISPIAWAPFVVLWFGI
    USA300_FPR3757  AISLWRFVAGFVVALLVAIPLGFLLGRNRWLYNAIEPLFQLIRPISPIAWAPFVVLWFGI
                    ************************************************************

    COL             GSLPAIAIIFIAAFFPIVFNTIKGVRDIEPQYLKIAANLNLTGWSLYRNILFPGAFKQIM
    N315            GSLPAIAIIFIAAFFPIVFNTIKGVRDIEPQYLKIAANLNLTGWSLYRNILFPGAFKQIM
    NCTC8325        GSLPAIAIIFIAAFFPIVFNTIKGVRDIEPQYLKIAANLNLTGWSLYRNILFPGAFKQIM
    Newman          GSLPAIAIIFIAAFFPIVFNTIKGVRDIEPQYLKIAANLNLTGWSLYRNILFPGAFKQIM
    USA300_FPR3757  GSLPAIAIIFIAAFFPIVFNTIKGVRDIEPQYLKIAANLNLTGWSLYRNILFPGAFKQIM
                    ************************************************************

    COL             AGIHMAVGTSWIFLVSGEMIGAQSGLGFLIVDARNMLNLEDVLAAIFFIGLFGFIIDRFI
    N315            AGIHMAVGTSWIFLVSGEMIGAQSGLGFLIVDARNMLNLEDVLAAIFFIGLFGFIIDRFI
    NCTC8325        AGIHMAVGTSWIFLVSGEMIGAQSGLGFLIVDARNMLNLEDVLAAIFFIGLFGFIIDRFI
    Newman          AGIHMAVGTSWIFLVSGEMIGAQSGLGFLIVDARNMLNLEDVLAAIFFIGLFGFIIDRFI
    USA300_FPR3757  AGIHMAVGTSWIFLVSGEMIGAQSGLGFLIVDARNMLNLEDVLAAIFFIGLFGFIIDRFI
                    ************************************************************

    COL             SYIEQFILRRFGE
    N315            SYIEQFILRRFGE
    NCTC8325        SYIEQFILRRFGE
    Newman          SYIEQFILRRFGE
    USA300_FPR3757  SYIEQFILRRFGE
                    *************