From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001028000
  • symbol?: brnQ1
  • description?: branched chain amino acid ABC transporter carrier protein

      descriptions from strain specific annotations:

    • branched chain amino acid ABC transporter carrier protein
    • branched-chain amino acid transport system II carrier protein
    • Branched-chain amino acid transport system carrier protein
    • putative branched-chain amino acid transport system carrier protein
    • LIVCS family branched chain amino acid:cation symporter
    • LIVCS family amino acid:cation symporter
  • strand?: -
  • coordinates?: 1300077..1301432
  • synteny block?: BlockID0005550
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0171 (brnQ1)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0187
    08BA02176:
    C248_0177
    11819-97:
    MS7_0179
    71193:
    ST398NM01_0203
    ECT-R 2:
    ECTR2_149 (brnQ)
    ED133:
    SAOV_0130 (brnQ1)
    ED98:
    SAAV_0154 (brnQ1)
    HO 5096 0412:
    SAEMRSA15_01510
    JH1:
    SaurJH1_0176
    JH9:
    SaurJH9_0171
    JKD6008:
    SAA6008_00164 (brnQ1)
    JKD6159:
    SAA6159_00167 (brnQ1)
    LGA251:
    SARLGA251_01570
    M013:
    M013TW_0173
    MRSA252:
    SAR0187
    MSHR1132:
    SAMSHR1132_01610
    MSSA476:
    SAS0161
    Mu3:
    SAHV_0185
    Mu50:
    SAV0186
    MW2:
    MW0160
    RF122:
    SAB0126c
    ST398:
    SAPIG0203 (brnQ)
    T0131:
    SAT0131_00178
    TCH60:
    HMPREF0772_10313 (brnQ2)
    TW20:
    SATW20_01960
    USA300_TCH1516:
    USA300HOU_0199
    VC40:
    SAVC_00695

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKKLTFKENMFIGSMLFGLFFGAGNLIFPIHLGQAAGSNVFIANLGFLITAIGLPFLGI
    N315            MKKKLTFKENMFIGSMLFGLFFGAGNLIFPIHLGQAAGSNVFIANLGFLITAIGLPFLGI
    NCTC8325        MKKKLTFKENMFIGSMLFGLFFGAGNLIFPIHLGQAAGSNVFIANLGFLITAIGLPFLGI
    Newman          MKKKLTFKENMFIGSMLFGLFFGAGNLIFPIHLGQAAGSNVFIANLGFLITAIGLPFLGI
    USA300_FPR3757  MKKKLTFKENMFIGSMLFGLFFGAGNLIFPIHLGQAAGSNVFIANLGFLITAIGLPFLGI
                    ************************************************************

    COL             IAIGISKTSGLFEIASRVNKTYAYIFTIALYLVIGPFFALPRLATTSFEIAFSPFLSPKQ
    N315            IAIGISKTSGLFEIASRVNKTYAYIFTIALYLVIGPFFALPRLATTSFEIAFSPFLSPKQ
    NCTC8325        IAIGISKTSGLFEIASRVNKTYAYIFTIALYLVIGPFFALPRLATTSFEIAFSPFLSPKQ
    Newman          IAIGISKTSGLFEIASRVNKTYAYIFTIALYLVIGPFFALPRLATTSFEIAFSPFLSPKQ
    USA300_FPR3757  IAIGISKTSGLFEIASRVNKTYAYIFTIALYLVIGPFFALPRLATTSFEIAFSPFLSPKQ
                    ************************************************************

    COL             ITLYLFIFSFVFFVIAWFFARKPSRILEYIGKFLNPVFLVLLAIILLFAFIHPLGGISDA
    N315            ITLYLFIFSFVFFVIAWFFARKPSRILEYIGKFLNPVFLVLLAIILLFAFIHPLGGISDA
    NCTC8325        ITLYLFIFSFVFFVIAWFFARKPSRILEYIGKFLNPVFLVLLAIILLFAFIHPLGGISDA
    Newman          ITLYLFIFSFVFFVIAWFFARKPSRILEYIGKFLNPVFLVLLAIILLFAFIHPLGGISDA
    USA300_FPR3757  ITLYLFIFSFVFFVIAWFFARKPSRILEYIGKFLNPVFLVLLAIILLFAFIHPLGGISDA
                    ************************************************************

    COL             PISKQYQSHALFNGFLDGYNTLDALASLAFGIIIVATIKKLGIENPTDIAKETIKSGTIS
    N315            PISKQYQSHALFNGFLDGYNTLDALASLAFGIIIVATIKKLGIENPTDIAKETIKSGTIS
    NCTC8325        PISKQYQSHALFNGFLDGYNTLDALASLAFGIIIVATIKKLGIENPTDIAKETIKSGTIS
    Newman          PISKQYQSHALFNGFLDGYNTLDALASLAFGIIIVATIKKLGIENPTDIAKETIKSGTIS
    USA300_FPR3757  PISKQYQSHALFNGFLDGYNTLDALASLAFGIIIVATIKKLGIENPTDIAKETIKSGTIS
                    ************************************************************

    COL             IIMMGIIYTLLAIMGTLSIGNFKLSENGGIALAQITQYYLGNYGIVLLSLIVMVACLKTA
    N315            IIMMGIIYTLLAIMGTLSIGHFKLSENGGIALAQITQYYLGNYGIVLLSLIVMVACLKTA
    NCTC8325        IIMMGIIYTLLAIMGTLSIGHFKLSENGGIALAQITQYYLGNYGIVLLSLIVMVACLKTA
    Newman          IIMMGIIYTLLAIMGTLSIGHFKLSENGGIALAQITQYYLGNYGIVLLSLIVMVACLKTA
    USA300_FPR3757  IIMMGIIYTLLAIMGTLSIGHFKLSENGGIALAQITQYYLGNYGIVLLSLIVMVACLKTA
                    ********************:***************************************

    COL             IGLITAFSETFEHLFPKMNYLAIATVVSFISFLFANVGLTKIIMYSVPVLMFLYPLAIAL
    N315            IGLITAFSETFEHLFPKMNYLAIATVVSFISFLFANVGLTKIIMYSVPVLMFLYPLAIAL
    NCTC8325        IGLITAFSETFEHLFPKMNYLAIATVVSFISFLFANVGLTKIIMYSVPVLMFLYPLAIAL
    Newman          IGLITAFSETFEHLFPKMNYLAIATVVSFISFLFANVGLTKIIMYSVPVLMFLYPLAIAL
    USA300_FPR3757  IGLITAFSETFEHLFPKMNYLAIATVVSFISFLFANVGLTKIIMYSVPVLMFLYPLAIAL
                    ************************************************************

    COL             IVLTLFSSKFHHSKLIYQCTIFFTMIAALVDGLKASPEFISSTSFSQTLINFSQKYLPLS
    N315            IVLTLFSSKFHHSKIIYQCTIFFTMIAALVDGLKASPEFISSTSFSQTLINFSQKYLPLS
    NCTC8325        IVLTLFSSKFHHSKLIYQCTIFFTMIAALVDGLKASPEFISSTSFSQTLINFSQKYLPLS
    Newman          IVLTLFSSKFHHSKLIYQCTIFFTMIAALVDGLKASPEFISSTSFSQTLINFSQKYLPLS
    USA300_FPR3757  IVLTLFSSKFHHSKLIYQCTIFFTMIAALVDGLKASPEFISSTSFSQTLINFSQKYLPLS
                    **************:*********************************************

    COL             DIGMGWVVLSLIGFIIGFIIYKIKHRKIPQA
    N315            DIGMGWVVLSLIGFIIGFIIYKIKHRKIP--
    NCTC8325        DIGMGWVVLSLIGFIIGFIIYKIKHRKIPQA
    Newman          DIGMGWVVLSLIGFIIGFIIYKIKHRKIPQA
    USA300_FPR3757  DIGMGWVVLSLIGFIIGFIIYKIKHRKIPQA
                    *****************************