From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001033000
  • symbol?:
  • description?: outer surface protein
  • strand?: +
  • coordinates?: 1306913..1308989
  • synteny block?: BlockID0005600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0191
    08BA02176:
    C248_0182
    11819-97:
    MS7_0183
    71193:
    ST398NM01_0208
    ECT-R 2:
    ECTR2_153
    ED133:
    SAOV_0135
    ED98:
    SAAV_0159
    HO 5096 0412:
    SAEMRSA15_01550
    JH1:
    SaurJH1_0180
    JH9:
    SaurJH9_0175
    JKD6008:
    SAA6008_00169
    JKD6159:
    SAA6159_00172
    LGA251:
    SARLGA251_01610
    M013:
    M013TW_0178
    MRSA252:
    SAR0191
    MSHR1132:
    SAMSHR1132_01650
    MSSA476:
    SAS0165
    Mu3:
    SAHV_0189
    Mu50:
    SAV0190
    MW2:
    MW0164
    RF122:
    SAB0130
    ST398:
    SAPIG0208
    T0131:
    SAT0131_00183 (dgkA)
    TCH60:
    HMPREF0772_10308
    TW20:
    SATW20_02000
    USA300_TCH1516:
    USA300HOU_0204
    VC40:
    SAVC_00720

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------MTGFSVYLGQPLDEAYIKRMIKQGYQMIFTSVQIPEEDDETKYHYFTKLLNLLK
    N315            ------MTGFSVYLGQPLDEAYIKRMIKQGYQMIFTSVQIPEEDDETKYHYFTKLLNLLK
    NCTC8325        -----------MYLGQPLDEAYIKRMIKQGYQMIFTSVQIPEEDDETKYHYFTKLLNLLK
    Newman          MLRRATLTGFSVYLGQPLDEAYIKRMIKQGYQMIFTSVQIPEEDDETKYHYFTKLLNLLK
    USA300_FPR3757  ------MTGFSVYLGQPLDEAYIKRMIKQGYQMIFTSVQIPEEDDETKYHYFTKLLNLLK
                               :************************************************

    COL             HEQVTYLIDANPSILTPSFYDHLRQYDAQFMIRIDHSTSIEAIEAIMAQGLKCCLNASII
    N315            YEQVTYLIDANPSILTPSFYEHLRQYDAQFMIRIDHSTSIEAIEAIMAQGLKCCLNASII
    NCTC8325        HEQVTYLIDANPSILTPSFYDHLRQYDAQFMIRIDHSTSIEAIEAIMAQGLKCCLNASII
    Newman          HEQVTYLIDANPSILTPSFYDHLRQYDAQFMIRIDHSTSIEAIEAIMAQGLKCCLNASII
    USA300_FPR3757  HEQVTYLIDANPSILTPSFYDHLRQYDAQFMIRIDHSTSIEAIEAIMAQGLKCCLNASII
                    :*******************:***************************************

    COL             SRELLTSLHQQLNDFTLLSFCHNYYPRPDTGLSVDLVNKKNELIYQFNPKAQIYGFIVGS
    N315            SRELLTSLHQQLNDFTLLSFCHNYYPRPDTGLSVDLVNKKNELIYQFNPKAQIYGFIVGS
    NCTC8325        SRELLTSLHQQLNDFTLLSFCHNYYPRPDTGLSVDLVNKKNELIYQFNPKAQIYGFIVGS
    Newman          SRELLTSLHQQLNDFTLLSFCHNYYPRPDTGLSVDLVNKKNELIYQFNPKAQIYGFIVGS
    USA300_FPR3757  SRELLTSLHQQLNDFTLLSFCHNYYPRPDTGLSVDLVNKKNELIYQFNPKAQIYGFIVGS
                    ************************************************************

    COL             DLRGPLHKGLPTIEATRHSHPVVAAKLLQETGVSEVLVGDSLIEMRQAKQLIDFCKHRHF
    N315            GLRGPLHKGLPTIEATRHSHPVVAAKLLQETGVSEVLVGDSLIEMRQAKQLIDFCKHRHF
    NCTC8325        DLRGPLHKGLPTIEATRHSHPVVAAKLLQETGVSEVLVGDSLIEMRQAKQLIDFCKHRHF
    Newman          DLRGPLHKGLPTIEATRHSHPVVAAKLLQETGVSEVLVGDSLIEMRQAKQLIDFCKHRHF
    USA300_FPR3757  DLRGPLHKGLPTIEATRHSHPVVAAKLLQETGVSEVLVGDSLIEMRQAKQLIDFCKHRHF
                    .***********************************************************

    COL             TLCIEEVFDTTVTYLFDMCHKVRPDNPENVIRSETSRQICPHSIQPQFTTQRRIGSVTVD
    N315            TLCIEEVFDTTVTYLFDMCHKVRPDNPENVIRSETSRQICPHSIQPQFTTQRRIGSVTVD
    NCTC8325        TLCIEEVFDTTVTYLFDMCHKVRPDNPENVIRSETSRQICPHSIQPQFTTQRRIGSVTVD
    Newman          TLCIEEVFDTTVTYLFDMCHKVRPDNPENVIRSETSRQICPHSIQPQFTTQRRIGSVTVD
    USA300_FPR3757  TLCIEEVFDTTVTYLFDMCHKVRPDNPENVIRSETSRQICPHSIQPQFTTQRRIGSVTVD
                    ************************************************************

    COL             NLNNGRYQGEMQIVRQTLSAHDNVNVVAQIIKEDLPLLSCIEPNDTFDFQKTRECKK
    N315            NLNNGRYQGEMQIVRQTLSAHDNVNVVAQIIKEDLPLLSCIEPNDTFDFQKTRECKK
    NCTC8325        NLNNGRYQGEMQIVRQTLSAHDNVNVVAQIIKEDLPLLSCIEPNDTFDFQKTRECKK
    Newman          NLNNGRYQGEMQIVRQTLSAHDNVNVVAQIIKEDLPLLSCIEPNDTFDFQKTRECKK
    USA300_FPR3757  NLNNGRYQGEMQIVRQTLSAHDNVNVVAQIIKEDLPLLSCIEPNDTFDFQKTRECKK
                    *********************************************************