From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001065000
  • symbol?: malE
  • description?: maltose ABC transporter substrate-binding protein

      descriptions from strain specific annotations:

    • maltose ABC transporter substrate-binding protein
    • maltose ABC transporter maltose-binding protein
    • extracellular solute-binding protein
    • putative maltose ABC transporter maltose-binding protein
    • Maltose/maltodextrin ABC transporter, substrate binding periplasmic protein MalE
    • putative extracellular sugar-binding lipoprotein
    • ABC transporter substrate-binding protein
    • bacterial extracellular solute-binding family protein
    • extracellular solute-binding family protein
    • Extracellular solute-binding protein, family 1
    • maltose/maltodextrin ABC superfamily ATP binding cassette transporter, binding protein
    • Maltose/maltodextrin-binding protein
    • maltose/maltodextrin transport system
    • maltose/maltodextrin transport system protein
    • maltose ABC transporter, maltose-binding protein, putative
  • strand?: +
  • coordinates?: 1342233..1343504
  • synteny block?: BlockID0005870
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0215
    08BA02176:
    C248_0198
    11819-97:
    MS7_0200
    71193:
    ST398NM01_0224
    ECT-R 2:
    ECTR2_175
    ED133:
    SAOV_0152
    ED98:
    SAAV_0180
    HO 5096 0412:
    SAEMRSA15_01730
    JH1:
    SaurJH1_0205
    JH9:
    SaurJH9_0199
    JKD6008:
    SAA6008_00183
    JKD6159:
    SAA6159_00189
    LGA251:
    SARLGA251_01780
    M013:
    M013TW_0194
    MRSA252:
    SAR0206
    MSHR1132:
    SAMSHR1132_01800
    MSSA476:
    SAS0190
    Mu3:
    SAHV_0213
    Mu50:
    SAV0214
    MW2:
    MW0190
    RF122:
    SAB0152
    ST398:
    SAPIG0224
    T0131:
    SAT0131_00199 (grpE)
    TCH60:
    HMPREF0772_10293
    TW20:
    SATW20_02150
    USA300_TCH1516:
    USA300HOU_0221
    VC40:
    SAVC_00810

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKILKCITLAVVMLLIVTACGPNRSKEDIDKALNKDNSKDKPNQLTMWVDGDKQMAFYK
    N315            MSKILKCITLAVVMLLIVTACGPNRSKEDIDKALNKDNSKDKPNQLTMWVDGDKQMAFYK
    NCTC8325        MSKILKCITLAVVMLLIVTACGPNRSKEDIDKALNKDNSKDKPNQLTMWVDGDKQMAFYK
    Newman          MSKILKCITLAVVMLLIVTACGPNRSKEDIDKALNKDNSKDKPNQLTMWVDGDKQMAFYK
    USA300_FPR3757  MSKILKCITLAVVMLLIVTACGPNRSKEDIDKALNKDNSKDKPNQLTMWVDGDKQMAFYK
                    ************************************************************

    COL             KITDQYTKKTGIKVKLVNIGQNDQLENISLDAPAGKGPDIFFLAHDNTGSAYLQGLAAEI
    N315            KITDQYTKKTGIKVKLVNIGQNDQLENISLDAPAGKGPDIFFLAHDNTGSAYLQGLAAEI
    NCTC8325        KITDQYTKKTGIKVKLVNIGQNDQLENISLDAPAGKGPDIFFLAHDNTGSAYLQGLAAEI
    Newman          KITDQYTKKTGIKVKLVNIGQNDQLENISLDAPAGKGPDIFFLAHDNTGSAYLQGLAAEI
    USA300_FPR3757  KITDQYTKKTGIKVKLVNIGQNDQLENISLDAPAGKGPDIFFLAHDNTGSAYLQGLAAEI
                    ************************************************************

    COL             KLSKDELKGFNKQALKAMNYDNKQLALPAIVETTALFYNKKLVKNAPQTLEEVEANAAKL
    N315            KLSKDELKGFNKQALKAMNYDNKQLALPAIVETTALFYNKKLVKNAPQTLEEVEANAAKL
    NCTC8325        KLSKDELKGFNKQALKAMNYDNKQLALPAIVETTALFYNKKLVKNAPQTLEEVEANAAKL
    Newman          KLSKDELKGFNKQALKAMNYDNKQLALPAIVETTALFYNKKLVKNAPQTLEEVEANAAKL
    USA300_FPR3757  KLSKDELKGFNKQALKAMNYDNKQLALPAIVETTALFYNKKLVKNAPQTLEEVEANAAKL
                    ************************************************************

    COL             TDSKKKQYGMLFDAKNFYFNYPFLFGNDDYIFKKNGSEYDIHQLGLNSKHVVKNAERLQK
    N315            TDSKKKQYGMLFDAKNFYFNYPFLFGNDDYIFKKNGSEYDIHQLGLNSKHVVKNAERLQK
    NCTC8325        TDSKKKQYGMLFDAKNFYFNYPFLFGNDDYIFKKNGSEYDIHQLGLNSKHVVKNAERLQK
    Newman          TDSKKKQYGMLFDAKNFYFNYPFLFGNDDYIFKKNGSEYDIHQLGLNSKHVVKNAERLQK
    USA300_FPR3757  TDSKKKQYGMLFDAKNFYFNYPFLFGNDDYIFKKNGSEYDIHQLGLNSKHVVKNAERLQK
                    ************************************************************

    COL             WYDKGYLPKAATHDVMIGLFKEGKVGQFVTGPWNINEYQETFGKDLGVTTLPTDGGKPMK
    N315            WYDKGYLPKAATHDVMIGLFKEGKVGQFVTGPWNINEYQETFGKDLGVTTLPTDGGKPMK
    NCTC8325        WYDKGYLPKAATHDVMIGLFKEGKVGQFVTGPWNINEYQETFGKDLGVTTLPTDGGKPMK
    Newman          WYDKGYLPKAATHDVMIGLFKEGKVGQFVTGPWNINEYQETFGKDLGVTTLPTDGGKPMK
    USA300_FPR3757  WYDKGYLPKAATHDVMIGLFKEGKVGQFVTGPWNINEYQETFGKDLGVTTLPTDGGKPMK
                    ************************************************************

    COL             PFLGVRGWYLSEYSKHKYWAKDLMLYITSKDTLQKYTDEMSEITGRVDVKSSNPNLKVFE
    N315            PFLGVRGWYLSEYSKHKYWAKDLMLYITSKDTLQKYTDEMSEITGRVDVKSSNPNLKVFE
    NCTC8325        PFLGVRGWYLSEYSKHKYWAKDLMLYITSKDTLQKYTDEMSEITGRVDVKSSNPNLKVFE
    Newman          PFLGVRGWYLSEYSKHKYWAKDLMLYITSKDTLQKYTDEMSEITGRVDVKSSNPNLKVFE
    USA300_FPR3757  PFLGVRGWYLSEYSKHKYWAKDLMLYITSKDTLQKYTDEMSEITGRVDVKSSNPNLKVFE
                    ************************************************************

    COL             KQARHAEPMPNIPEMRQVWEPMGNASIFISNGKNPKQALDEATNDITQNIKILHPSQNDK
    N315            KQARHAEPMPNIPEMRQVWEPMGNASIFISNGKNPKQALDEATNDITQNIKILHPSQNDK
    NCTC8325        KQARHAEPMPNIPEMRQVWEPMGNASIFISNGKNPKQALDEATNDITQNIKILHPSQNDK
    Newman          KQARHAEPMPNIPEMRQVWEPMGNASIFISNGKNPKQALDEATNDITQNIKILHPSQNDK
    USA300_FPR3757  KQARHAEPMPNIPEMRQVWEPMGNASIFISNGKNPKQALDEATNDITQNIKILHPSQNDK
                    ************************************************************

    COL             KGD
    N315            KGD
    NCTC8325        KGD
    Newman          KGD
    USA300_FPR3757  KGD
                    ***