From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001071000
  • symbol?:
  • description?: xylose isomerase

      descriptions from strain specific annotations:

    • xylose isomerase
    • Sugar phosphate isomerase/epimerase
    • Inosose isomerase
    • IolE protein-like protein
    • Sugar phosphate isomerase/epimerase family protein
    • xylose isomerase-like TIM barrel family protein
  • strand?: +
  • coordinates?: 1348209..1349220
  • synteny block?: BlockID0005930
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0220
    08BA02176:
    C248_0203
    11819-97:
    MS7_0205
    71193:
    ST398NM01_0229
    ECT-R 2:
    ECTR2_180
    ED133:
    SAOV_0157
    ED98:
    SAAV_0185
    HO 5096 0412:
    SAEMRSA15_01780
    JH1:
    SaurJH1_0210
    JH9:
    SaurJH9_0204
    JKD6008:
    SAA6008_00188 (iolE)
    JKD6159:
    SAA6159_00194 (iolE)
    LGA251:
    SARLGA251_01830
    M013:
    M013TW_0199
    MRSA252:
    SAR0211
    MSHR1132:
    SAMSHR1132_01850
    MSSA476:
    SAS0195
    Mu3:
    SAHV_0218
    Mu50:
    SAV0219
    MW2:
    MW0195
    RF122:
    SAB0158
    ST398:
    SAPIG0229
    T0131:
    SAT0131_00205 (holA)
    TCH60:
    HMPREF0772_10288
    TW20:
    SATW20_02200
    USA300_TCH1516:
    USA300HOU_0226
    VC40:
    SAVC_00835

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------------MKIGVFSVLFYDKNFEDMLDYVSESGLDMIEVGTGGNPGDKFCKLD
    N315            --------------MKIGVFSVLFYDKNFEDMLDYVAESGLDMIEVGTGGNPGDKFCKLD
    NCTC8325        --------------MKIGVFSVLFYDKNFEDMLDYVSESGLDMIEVGTGGNPGDKFCKLD
    Newman          MIQNSQYKKKECFSMKIGVFSVLFYDKNFEDMLDYVSESGLDMIEVGTGGNPGDKFCKLD
    USA300_FPR3757  --------------MKIGVFSVLFYDKNFEDMLDYVSESGLDMIEVGTGGNPGDKFCKLD
                                  **********************:***********************

    COL             ELLENEDKRQAFMKSITDRGLQISGFSCHNNPISPDPIEAKEADETLRKTIRLANLLDVP
    N315            ELLENEDKRQAFMKSITDRGLQISGFSCHNNPISPDPIEAKEADETLRKTIRLANLLDVP
    NCTC8325        ELLENEDKRQAFMKSITDRGLQISGFSCHNNPISPDPIEAKEADETLRKTIRLANLLDVP
    Newman          ELLENEDKRQAFMKSITDRGLQISGFSCHNNPISPDPIEAKEADETLRKTIRLANLLDVP
    USA300_FPR3757  ELLENEDKRQAFMKSITDRGLQISGFSCHNNPISPDPIEAKEADETLRKTIRLANLLDVP
                    ************************************************************

    COL             VVNTFSGIAGSDDTAKKPNWPVTPWPTAYSEIYDYQWNEKLIPYWQDLAEFAKEQDVKIA
    N315            VVNTFSGIAGSDDTAKKPNWPVTPWPTAYSEIYDYQWNEKLIPYWQDLAEFAKEQDVKIA
    NCTC8325        VVNTFSGIAGSDDTAKKPNWPVTPWPTAYSEIYDYQWNEKLIPYWQDLAEFAKEQDVKIA
    Newman          VVNTFSGIAGSDDTAKKPNWPVTPWPTAYSEIYDYQWNEKLIPYWQDLAEFAKEQDVKIA
    USA300_FPR3757  VVNTFSGIAGSDDTAKKPNWPVTPWPTAYSEIYDYQWNEKLIPYWQDLAEFAKEQDVKIA
                    ************************************************************

    COL             IELHAGFLVHTPYTMLKLREATNEYIGANLDPSHLWWQGIDPIAAIRILGQANAIHHFHA
    N315            IELHAGFLVHTPYTMLKLREATNEYIGANLDPSHLWWQGIDPIAAIRILGQANAIHHFHA
    NCTC8325        IELHAGFLVHTPYTMLKLREATNEYIGANLDPSHLWWQGIDPIAAIRILGQANAIHHFHA
    Newman          IELHAGFLVHTPYTMLKLREATNEYIGANLDPSHLWWQGIDPIAAIRILGQANAIHHFHA
    USA300_FPR3757  IELHAGFLVHTPYTMLKLREATNEYIGANLDPSHLWWQGIDPIAAIRILGQANAIHHFHA
                    ************************************************************

    COL             KDTYINQENVNMYGLTDMQPYGNVATRAWTFRTVGYGHSPYVWADIISQLIINGYDYVLS
    N315            KDTYINQENVNMYGLTDMQPYGNVATRAWTFRTVGYGHSPYVWADIISQLIINGYDYVLS
    NCTC8325        KDTYINQENVNMYGLTDMQPYGNVATRAWTFRTVGYGHSPYVWADIISQLIINGYDYVLS
    Newman          KDTYINQENVNMYGLTDMQPYGNVATRAWTFRTVGYGHSPYVWADIISQLIINGYDYVLS
    USA300_FPR3757  KDTYINQENVNMYGLTDMQPYGNVATRAWTFRTVGYGHSPYVWADIISQLIINGYDYVLS
                    ************************************************************

    COL             IEHEDPIMSVEEGFQKACQTLKSVNIYDKPADMWWA
    N315            IEHEDPIMSVEEGFQKACQTLKSVNIYDKPADMWWA
    NCTC8325        IEHEDPIMSVEEGFQKACQTLKSVNIYDKPADMWWA
    Newman          IEHEDPIMSVEEGFQKACQTLKSVNIYDKPADMWWA
    USA300_FPR3757  IEHEDPIMSVEEGFQKACQTLKSVNIYDKPADMWWA
                    ************************************