From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001076000
  • symbol?: hptR
  • description?: two-component response regulator

      descriptions from strain specific annotations:

    • two-component response regulator
    • response regulator receiver
    • AraC family transcriptional regulator
    • response regulator receiver protein
    • putative response regulator
    • AraC family DNA-binding response regulator
    • response regulator receiver domain-containing protein
    • DNA-binding response regulator AraC family protein
    • response regulatory protein
    • HTH-type transcriptional regulator AraC
  • strand?: -
  • coordinates?: 1352119..1352877
  • synteny block?: BlockID0005980
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0223
    08BA02176:
    C248_0206
    11819-97:
    MS7_0208
    71193:
    ST398NM01_0232
    ECT-R 2:
    ECTR2_183
    ED133:
    SAOV_0160
    ED98:
    SAAV_0188
    HO 5096 0412:
    SAEMRSA15_01810
    JH1:
    SaurJH1_0213
    JH9:
    SaurJH9_0207
    JKD6008:
    SAA6008_00191
    JKD6159:
    SAA6159_00197
    LGA251:
    SARLGA251_01860
    M013:
    M013TW_0202
    MRSA252:
    SAR0214
    MSHR1132:
    SAMSHR1132_01880
    MSSA476:
    SAS0198
    Mu3:
    SAHV_0222
    Mu50:
    SAV0223
    MW2:
    MW0198
    RF122:
    SAB0161c
    ST398:
    SAPIG0232
    T0131:
    SAT0131_00208
    TCH60:
    HMPREF0772_10285
    TW20:
    SATW20_02230
    USA300_TCH1516:
    USA300HOU_0230
    VC40:
    SAVC_00850

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFKVVICDDERIIREGLKQIIPWGDYHFNTIYTAKDGVEALSLIQQHQPELVITDIRMPR
    N315            MFKVVICDDERIIREGLKQIIPWGDYHFNTIYTAKDGVEALSLIQQHQPELVITDIRMPR
    NCTC8325        MFKVVICDDERIIREGLKQIIPWGDYHFNTIYTAKDGVEALSLIQQHQPELVITDIRMPR
    Newman          MFKVVICDDERIIREGLKQIIPWGDYHFNTIYTAKDGVEALSLIQQHQPELVITDIRMPR
    USA300_FPR3757  MFKVVICDDERIIREGLKQIIPWGDYHFNTIYTAKDGVEALSLIQQHQPELVITDIRMPR
                    ************************************************************

    COL             KNGVDLLNDIAHLDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQLEVILGRLVRT
    N315            KNGVDLLNDIALLDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQLEVILGRLVRT
    NCTC8325        KNGVDLLNDIAHLDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQLEVILGRLVRT
    Newman          KNGVDLLNDIAHLDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQLEVILGRLVRT
    USA300_FPR3757  KNGVDLLNDIAHLDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQLEVILGRLVRT
                    *********** ************************************************

    COL             LLEQQSQNGRSLASCHDAFQPLLKVEYDDYYVNQIVDQIKQSYQTKVTVSDLIQHIDVSE
    N315            LLEQQSQNGRSLASCHDAFQPLLKVEYDDYYVNQIVDQIKQSYQTKVTVSDLIQHIDVSE
    NCTC8325        LLEQQSQNGRSLASCHDAFQPLLKVEYDDYYVNQIVDQIKQSYQTKVTVSDLIQHIDVSE
    Newman          LLEQQSQNGRSLASCHDAFQPLLKVEYDDYYVNQIVDQIKQSYQTKVTVSDLIQHIDVSE
    USA300_FPR3757  LLEQQSQNGRSLASCHDAFQPLLKVEYDDYYVNQIVDQIKQSYQTKVTVSDLIQHIDVSE
                    ************************************************************

    COL             SYAMRTFKDHVGITIVDYLNRYRILQSLQLLDRHYKHYEIADKVGFSEYKMFSYHFKKYL
    N315            SYAMRTFKDHVGITIVDYLNRYRILQSLQLLDRHYKHYEIADKVGFSEYKMFSYHFKKYL
    NCTC8325        SYAMRTFKDHVGITIVDYLNRYRILQSLQLLDRHYKHYEIADKVGFSEYKMFSYHFKKYL
    Newman          SYAMRTFKDHVGITIVDYLNRYRILQSLQLLDRHYKHYEIADKVGFSEYKMFSYHFKKYL
    USA300_FPR3757  SYAMRTFKDHVGITIVDYLNRYRILQSLQLLDRHYKHYEIADKVGFSEYKMFSYHFKKYL
                    ************************************************************

    COL             QMSPSDYCKQAK
    N315            QMSPSDYCKQAK
    NCTC8325        QMSPSDYCKQAK
    Newman          QMSPSDYCKQAK
    USA300_FPR3757  QMSPSDYCKQAK
                    ************