From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001093000
  • symbol?: fadB
  • description?: 3-hydroxyacyl-CoA dehydrogenase

      descriptions from strain specific annotations:

    • 3-hydroxyacyl-CoA dehydrogenase
    • 3-hydroxyacyl-CoA dehydrogenase FadB-like protein
    • 3-hydroxyacyl-CoA dehydrogenase, NAD-binding
    • 3-hydroxyacyl-CoA dehydrogenase NAD-binding
    • 3-hydroxyacyl-CoA dehydrogenase protein
    • Enoyl-CoA hydratase / Enoyl-CoA hydratase /3-hydroxyacyl-CoA dehydrogenase
    • Enoyl-CoA hydratase / Enoyl-CoA hydratase [valine degradation] / 3-hydroxyacyl-CoA dehydrogenase
    • enoyl-CoA hydratase/isomerase family protein
    • fatty oxidation complex protein
    • putative fatty oxidation complex protein
  • strand?: -
  • coordinates?: 1368219..1370480
  • synteny block?: BlockID0006150
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0168 (fadB)
    USA300_FPR3757:
    04-02981:
    SA2981_0232
    08BA02176:
    C248_0216 (fadB)
    11819-97:
    MS7_0218
    71193:
    ST398NM01_0242
    ECT-R 2:
    ECTR2_192
    ED133:
    SAOV_0169
    ED98:
    SAAV_0197
    HO 5096 0412:
    SAEMRSA15_01900 (fadB)
    JH1:
    SaurJH1_0222
    JH9:
    SaurJH9_0216
    JKD6008:
    SAA6008_00201 (fadB)
    JKD6159:
    SAA6159_00206 (fadB)
    LGA251:
    SARLGA251_01960 (fadB)
    M013:
    M013TW_0211
    MRSA252:
    SAR0224 (fadB)
    MSHR1132:
    SAMSHR1132_01970
    MSSA476:
    SAS0208
    Mu3:
    SAHV_0231
    Mu50:
    SAV0232
    MW2:
    MW0208
    RF122:
    SAB0171c
    ST398:
    SAPIG0242
    T0131:
    SAT0131_00219
    TCH60:
    HMPREF0772_10273 (fadB)
    TW20:
    SATW20_02330 (fadB)
    USA300_TCH1516:
    USA300HOU_0241
    VC40:
    SAVC_00900

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTINKVTVLGAGTMGAQLAALFVNAGLKVKLLDIVVDKNDPNLIAKKSYDKITDKKRPLL
    N315            MTINKVTVLGAGTMGAQLAALFVNAGLKVKLLDIVVDKNDPNLIAKKSYDKITDKKRPLL
    NCTC8325        MTINKVTVLGAGTMGAQLAALFVNAGLKVKLLDIVVDKNDPNLIAKKSYDKITDKKRPLL
    Newman          MTINKVTVLGAGTMGAQLAALFVNAGLKVKLLDIVVDKNDPNLIAKKSYDKITDKKRPLL
    USA300_FPR3757  MTINKVTVLGAGTMGAQLAALFVNAGLKVKLLDIVVDKNDPNLIAKKSYDKITDKKRPLL
                    ************************************************************

    COL             FDLNLASHLTYGNFDDDLVNDDADLYIEAVKEDIEIKHAVWQQVLQHAKEDALFATNTSG
    N315            FDLNLVSHLTYGNFDDDLVNDDADLYIEAVKEDIEIKHAVWQQVLQHAKEDALFATNTSG
    NCTC8325        FDLNLASHLTYGNFDDDLVNDDADLYIEAVKEDIEIKHAVWQQVLQHAKEDALFATNTSG
    Newman          FDLNLASHLTYGNFDDDLVNDDADLYIEAVKEDIEIKHAVWQQVLQHAKEDALFATNTSG
    USA300_FPR3757  FDLNLASHLTYGNFDDDLVNDDADLYIEAVKEDIEIKHAVWQQVLQHAKEDALFATNTSG
                    *****.******************************************************

    COL             IPINAIAQAFNEKDQERFFGLHFFNPPRIMKLVELIPTSHTKESIILDVKNFAQNVLGKG
    N315            IPINAIAQAFNEKDQERFFGLHFFNPPRIMKLVELIPTSHTKESIILDVKNFAQNVLGKG
    NCTC8325        IPINAIAQAFNEKDQERFFGLHFFNPPRIMKLVELIPTSHTKESIILDVKNFAQNVLGKG
    Newman          IPINAIAQAFNEKDQERFFGLHFFNPPRIMKLVELIPTSHTKESIILDVKNFAQNVLGKG
    USA300_FPR3757  IPINAIAQAFNEKDQERFFGLHFFNPPRIMKLVELIPTSHTKESIILDVKNFAQNVLGKG
                    ************************************************************

    COL             VIVVNDVPGFVANRVGTQTMNDIMYRAEQHKISIVDVDALTGQAIGRPKTGTYALSDLVG
    N315            VIVVNDVPGFVANRVGTQTMNDIMYRAEQHKLSIVDVDALTGQAIGRPKTGTYALSDLVG
    NCTC8325        VIVVNDVPGFVANRVGTQTMNDIMYRAEQHKISIVDVDALTGQAIGRPKTGTYALSDLVG
    Newman          VIVVNDVPGFVANRVGTQTMNDIMYRAEQHKISIVDVDALTGQAIGRPKTGTYALSDLVG
    USA300_FPR3757  VIVVNDVPGFVANRVGTQTMNDIMYRAEQHKISIVDVDALTGQAIGRPKTGTYALSDLVG
                    *******************************:****************************

    COL             LDIAVSVIKGMQQVPEETPYFHDVKIVNTLFDNGALGRKTKQGFYKKDKETKARLVYDVE
    N315            LDIAVSVIKGMQQVPEETPYFHDVKIVNTLFDNGALGRKTKQGFYKKDKETKARLVYDVE
    NCTC8325        LDIAVSVIKGMQQVPEETPYFHDVKIVNTLFDNGALGRKTKQGFYKKDKETKARLVYDVE
    Newman          LDIAVSVIKGMQQVPEETPYFHDVKIVNTLFDNGALGRKTKQGFYKKDKETKARLVYDVE
    USA300_FPR3757  LDIAVSVIKGMQQVPEETPYFHDVKIVNTLFDNGALGRKTKQGFYKKDKETKARLVYDVE
                    ************************************************************

    COL             KQDYVPVSQPQLPILNEFNKDLVHNLDTIFNAQDEAGLFLWETLRNNFYYSAINVPKATD
    N315            KQDYVPVSQPQLPILNEFNKDLVHNLDVIFNAQDEAGLFLWETLRNNFYYSAINVPKATD
    NCTC8325        KQDYVPVSQPQLPILNEFNKDLVHNLDTIFNAQDEAGLFLWETLRNNFYYSAINVPKATD
    Newman          KQDYVPVSQPQLPILNEFNKDLVHNLDTIFNAQDEAGLFLWETLRNNFYYSAINVPKATD
    USA300_FPR3757  KQDYVPVSQPQLPILNEFNKDLVHNLDTIFNAQDEAGLFLWETLRNNFYYSAINVPKATD
                    ***************************.********************************

    COL             DFRDIDRALVWGFNWKLGPFQLWDAMGYERVKTRMEDELGDLPQWISDLDGGFYKQDETI
    N315            DFRDIDRALVWGFNWKLGPFQLWDAMGYERVKTRMEDELGDLPQWISDLDGGFYKQDETI
    NCTC8325        DFRDIDRALVWGFNWKLGPFQLWDAMGYERVKTRMEDELGDLPQWISDLDGGFYKQDETI
    Newman          DFRDIDRALVWGFNWKLGPFQLWDAMGYERVKTRMEDELGDLPQWISDLDGGFYKQDETI
    USA300_FPR3757  DFRDIDRALVWGFNWKLGPFQLWDAMGYERVKTRMEDELGDLPQWISDLDGGFYKQDETI
                    ************************************************************

    COL             EYATPISHFVKDELWDKGDAKLSVTHDDQLLLKLQSKNNVITDEFNDALVDAIDLLENDH
    N315            EYATPVSHFVKDELWDKGDAKLSVTHDDQLLLKLQSKNNVITDEFNDALVDAIDLLENDH
    NCTC8325        EYATPISHFVKDELWDKGDAKLSVTHDDQLLLKLQSKNNVITDEFNDALVDAIDLLENDH
    Newman          EYATPISHFVKDELWDKGDAKLSVTHDDQLLLKLQSKNNVITDEFNDALVDAIDLLENDH
    USA300_FPR3757  EYATPISHFVKDELWDKGDAKLSVTHDDQLLLKLQSKNNVITDEFNDALVDAIDLLENDH
                    *****:******************************************************

    COL             YTSMVIYADGNNFSVGANLFLMKKAHEDGLVDDVVAQSIDKLHYSFNRLKYSLKPVVTAV
    N315            YTSMVIYADGNNFSVGANLFLMKKAHEDGLVDDVVAQSIDKLHYSFNRLKYSLKPVVTAV
    NCTC8325        YTSMVIYADGNNFSVGANLFLMKKAHEDGLVDDVVAQSIDKLHYSFNRLKYSLKPVVTAV
    Newman          YTSMVIYADGNNFSVGANLFLMKKAHEDGLVDDVVAQSIDKLHYSFNRLKYSLKPVVTAV
    USA300_FPR3757  YTSMVIYADGNNFSVGANLFLMKKAHEDGLVDDVVAQSIDKLHYSFNRLKYSLKPVVTAV
                    ************************************************************

    COL             QGRALGGGCELVLYSPIVVAASETYIGLVEAGVGLLPSGGGLAEMADRILRTSHKFDDKQ
    N315            QGRALGGGCELVLYSPIVVAASETYIGLVEAGVGLLPSGGGLAEMADRILRTSHKFDDKQ
    NCTC8325        QGRALGGGCELVLYSPIVVAASETYIGLVEAGVGLLPSGGGLAEMADRILRTSHKFDDKQ
    Newman          QGRALGGGCELVLYSPIVVAASETYIGLVEAGVGLLPSGGGLAEMADRILRTSHKFDDKQ
    USA300_FPR3757  QGRALGGGCELVLYSPIVVAASETYIGLVEAGVGLLPSGGGLAEMADRILRTSHKFDDKQ
                    ************************************************************

    COL             ASMTKVLTNIAFAKVSTNAFEARRYGYLRDTDTIIFNTAQRVEVALKRAKYEAETNYIPN
    N315            ASMTKVLTNIAFAKVSTNAFEARRYGYLRDTDTIIFNTAQRVEVALKRAKYEAETNYIPN
    NCTC8325        ASMTKVLTNIAFAKVSTNAFEARRYGYLRDTDTIIFNTAQRVEVALKRAKYEAETNYIPN
    Newman          ASMTKVLTNIAFAKVSTNAFEARRYGYLRDTDTIIFNTAQRVEVALKRAKYEAETNYIPN
    USA300_FPR3757  TSMTKVLTNIAFAKVSTNAFEARRYGYLRDTDTIIFNTAQRVEVALKRAKYEAETNYIPN
                    :***********************************************************

    COL             PRHQYIALGEDFKALIQGQLDAQRRGHFISDHDYHIALNIATILAGGDLPRNTFINQRYI
    N315            PRHQYIALGEDFKALIQGQLDAQRRGHFISDHDYHIALNIATILAGGDLPRNTFINQRYI
    NCTC8325        PRHQYIALGEDFKALIQGQLDAQRRGHFISDHDYHIALNIATILAGGDLPRNTFINQRYI
    Newman          PRHQYIALGEDFKALIQGQLDAQRRGHFISDHDYHIALNIATILAGGDLPRNTFINQRYI
    USA300_FPR3757  PRHQYIALGEDFKALIQGQLDAQRRGHFISDHDYHIALNIATILAGGDLPRNTFINQRYI
                    ************************************************************

    COL             QSLEKIGFIDLLKSKKSYERIAHMLKTGKPLRN
    N315            QSLEKIGFIDLLKSKKSYERIAHMLKTGKPLRN
    NCTC8325        QSLEKIGFIDLLKSKKSYERIAHMLKTGKPLRN
    Newman          QSLEKIGFIDLLKSKKSYERIAHMLKTGKPLRN
    USA300_FPR3757  QSLEKIGFIDLLKSKKSYERIAHMLKTGKPLRN
                    *********************************