From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001114000
  • symbol?:
  • description?: transcriptional antiterminator

      descriptions from strain specific annotations:

    • transcriptional antiterminator
    • BglG family transcriptional antiterminator
    • transcriptional antiterminator BglG family protein
    • BglG family transcription antiterminator
    • galactitol operon regulator (Transcriptional antiterminator), BglG family / PTS system, mannitol/fructose-specific IIA component
    • PRD domain-containing protein
    • pseudogene
    • PTS regulator
    • PTS system mannitol (Cryptic)-specific transporter subunit IIA
    • putative galactitol operon regulator
    • putative PTS multidomain regulator
    • putative PTS multi-domain regulator(pseudogene)
    • putative transcriptional regulator
    • transcriptional antiterminator, BglG family
    • transcriptional antiterminator BglG
  • strand?: +
  • coordinates?: 1389351..1391468
  • synteny block?: BlockID0006340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0244
    08BA02176:
    C248_0230 (bglG)
    11819-97:
    MS7_0232
    71193:
    ST398NM01_0256
    ECT-R 2:
    ECTR2_205
    ED133:
    SAOV_0182
    ED98:
    SAAV_0210
    HO 5096 0412:
    SAEMRSA15_02030
    JH1:
    SaurJH1_0235
    JH9:
    SaurJH9_0229
    JKD6008:
    SAA6008_00217
    JKD6159:
    SAA6159_00221
    LGA251:
    SARLGA251_02080
    M013:
    M013TW_0225
    MRSA252:
    SAR0238
    MSHR1132:
    SAMSHR1132_02120
    MSSA476:
    SAS0220
    Mu3:
    SAHV_0243
    Mu50:
    SAV0244
    MW2:
    MW0220
    RF122:
    SAB0183
    ST398:
    SAPIG0256
    T0131:
    SAT0131_00235
    TCH60:
    HMPREF0772_10259
    TW20:
    SATW20_02460
    USA300_TCH1516:
    USA300HOU_0255
    VC40:
    SAVC_00960

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNGDNQQILREIVLNPTIHGKELESIFGLSRRQLGYRIQKINLWLEQEGYPKLERTSQGN
    N315            MNGDNQQILREIVLNPTIHGKELESIFGLSRRQLGYRIQKINLWLEQEGYPKLERTSQGN
    NCTC8325        MNGDNQQILREIVLNPTIHGKELESIFGLSRRQLGYRIQKINLWLEQEGYPKLERTSQGN
    Newman          MNGDNQQILREIVLNPTIHGKELESIFGLSRRQLGYRIQKINLWLEQEGYPKLERTSQGN
    USA300_FPR3757  MNGDNQQILREIVLNPTIHGKELESIFGLSRRQLGYRIQKINLWLEQEGYPKLERTSQGN
                    ************************************************************

    COL             FIVSSEIMTLFKRDVSEQQMLNGNNVIFSIETRRYYLMLMLFSKENAMSLNHFSIDLQVS
    N315            FIVSSEIMTLFKRDVSEQQMLNGNNVIFSIETRRYYLMLMLFSKENAMSLNHFSIDLQVS
    NCTC8325        FIVSSEIMTLFKRDVSEQQMLNGNNVIFSIETRRYYLMLMLFSKENAMSLNHFSIDLQVS
    Newman          FIVSSEIMTLFKRDVSEQQMLNGNNVIFSIETRRYYLMLMLFSKENAMSLNHFSIDLQVS
    USA300_FPR3757  FIVSSEIMTLFKRDVSEQQMLNGNNVIFSIETRRYYLMLMLFSKENAMSLNHFSIDLQVS
                    ************************************************************

    COL             KNTVIHDINHVKEQLENHGLSLKYSRKHGYEIVGDEFEVRRFFIKLIDQRLNHDITKSEV
    N315            KNTVIHDINHVKEQLEDHGLSLKYSRKHGYEIVGDEFEVRRFFIKLIDQRLNHDITKSEV
    NCTC8325        KNTVIHDINHVKEQLENHGLSLKYSRKHGYEIVGDEFEVRRFFIKLIDQRLNHDITKSEV
    Newman          KNTVIHDINHVKEQLENHGLSLKYSRKHGYEIVGDEFEVRRFFIKLIDQRLNHDITKSEV
    USA300_FPR3757  KNTVIHDINHVKEQLENHGLSLKYSRKHGYEIVGDEFEVRRFFIKLIDQRLNHDITKSEV
                    ****************:*******************************************

    COL             LKALNLTFEDIAYQKDKIKQVEQFLKSRFIDKSLSSLPYVLCVIRRRIQSGHVMNPLNIN
    N315            LKALNLTFEDIAYQKDKIKQVEQFLKSRFIDKSLSSLPYVLCVIRRRIQSGHVMNPLNIN
    NCTC8325        LKALNLTFEDIAYQKDKIKQVEQFLKSRFIDKSLSSLPYVLCVIRRRIQSGHVMNPLNIN
    Newman          LKALNLTFEDIAYQKDKIKQVEQFLKSRFIDKSLSSLPYVLCVIRRRIQSGHVMNPLNIN
    USA300_FPR3757  LKALNLTFEDIAYQKDKIKQVEQFLKSRFIDKSLSSLPYVLCVIRRRIQSGHVMNPLNIN
                    ************************************************************

    COL             YQYLRDTKEYQATEIMTQHEPDLPEAEKLYLTLHLLSTSVQWTDLQESDSISNLTMAIAQ
    N315            YQYLRDTKEYQATEIMTQHEPDLPEAEKLYLTLHLLSTSVQWTDLQESDNISNLTMAIAQ
    NCTC8325        YQYLRDTKEYQATEIMTQHEPDLPEAEKLYLTLHLLSTSVQWTDLQESDSISNLTMAIAQ
    Newman          YQYLRDTKEYQATEIMTQHEPDLPEAEKLYLTLHLLSTSVQWTDLQESDSISNLTMAIAQ
    USA300_FPR3757  YQYLRDTKEYQATEIMTQHEPDLPEAEKLYLTLHLLSTSVQWTDLQESDSISNLTMAIAQ
                    *************************************************.**********

    COL             MIHHFEQITFINIEDKEKLSQQLLLHLTPAFYRIKYNLTDRDELINPLQGNYQSLFHMVK
    N315            MIHHFEQITFINIEDKEKLSQQLLLHLTPAFYRIKYNLTDRDELINPLQGNYQSLFHMVK
    NCTC8325        MIHHFEQITFINIEDKEKLSQQLLLHLTPAFYRIKYNLTDRDELINPLQGNYQSLFHMVK
    Newman          MIHHFEQITFINIEDKEKLSQQLLLHLTPAFYRIKYNLTDRDELINPLQGNYQSLFHMVK
    USA300_FPR3757  MIHHFEQITFINIEDKEKLSQQLLLHLTPAFYRIKYNLTDRDELINPLQGNYQSLFHMVK
                    ************************************************************

    COL             QSCQSLTEYFGKSLPDNEIAYLTMLFGGSLRRQDENFDGKIKAIIVCTQGTSVSQMMLYE
    N315            QSCQSLTEYFGKSLPDNEIAYLTMLFGGSLRRQDENFDGKIKAIIVCTQGTSVSQMMLYE
    NCTC8325        QSCQSLTEYFGKSLPDNEIAYLTMLFGGSLRRQDENFDGKIKAIIVCTQGTSVSQMMLYE
    Newman          QSCQSLTEYFGKSLPDNEIAYLTMLFGGSLRRQDENFDGKIKAIIVCTQGTSVSQMMLYE
    USA300_FPR3757  QSCQSLTEYFGKSLPDNEIAYLTMLFGGSLRRQDENFDGKIKAIIVCTQGTSVSQMMLYE
                    ************************************************************

    COL             LRNLFPEIIFLDAISLRTFENYTLDYDIVFSPMFVLTHKKLFITKVALSENEQRKLRKEV
    N315            LRNLFPEIIFLDAISLRTFENYTLDYDIVFSPMFVLTHKKLFITKVALSENEQRKLRKEV
    NCTC8325        LRNLFPEIIFLDAISLRTFENYTLDYDIVFSPMFVLTHKKLFITKVALSENEQRKLRKEV
    Newman          LRNLFPEIIFLDAISLRTFENYTLDYDIVFSPMFVLTHKKLFITKVALSENEQRKLRKEV
    USA300_FPR3757  LRNLFPEIIFLDAISLRTFENYTLDYDIVFSPMFVLTHKKLFITKVALSENEQRKLRKEV
                    ************************************************************

    COL             MKYINKESADIDKEINKLMALIERTTTVNDITELRDGLEDFIANYNSISTINGSIVTQNK
    N315            MKYINKESADIDKEINKLMALIERTTTVNDITELRDGLEDFIANYNSISTINGSIVTQNK
    NCTC8325        MKYINKESADIDKEINKLMALIERTTTVNDITELRDGLEDFIANYNSISTINGSIVTQNK
    Newman          MKYINKESADIDKEINKLMALIERTTTVNDITELRDGLEDFIANYNSISTINGSIVTQNK
    USA300_FPR3757  MKYINKESADIDKEINKLMALIERTTTVNDITELRDGLEDFIANYNSISTINGSIVTQNK
                    ************************************************************

    COL             TLDLADLIPARHVKRMHHVENIDEAIAKASDVLVANHFIDIKYIHEMQQVFDDSYMVIMQ
    N315            TLDLADLIPARHVKRMHHVENIDEAIAKASDVLVANHFIDIKYIHEMQQVFDDSYMVIMQ
    NCTC8325        TLDLADLIPARHVKRMHHVENIDEAIAKASDVLVANHFIDIKYIHEMQQVFDDSYMVIMQ
    Newman          TLDLADLIPARHVKRMHHVENIDEAIAKASDVLVANHFIDIKYIHEMQQVFDDSYMVIMQ
    USA300_FPR3757  TLDLADLIPARHVKRMHHVENIDEAIAKASDVLVANHFIDIKYIHEMQQVFDDSYMVIMQ
                    ************************************************************

    COL             NIAIPHAYSEKHVHKTAMSMLILQEPIYMSDGTAIHIIVPIAAVDKVTHLRALLQLRDVA
    N315            NIAIPHAYSEKHVHKTAMSMLILQEPIYMSDGTAIHIIVPIAAVDKVTHLRALLQLRDVA
    NCTC8325        NIAIPHAYSEKHVHKTAMSMLILQEPIYMSDGTAIHIIVPIAAVDKVTHLRALLQLRDVA
    Newman          NIAIPHAYSEKHVHKTAMSMLILQEPIYMSDGTAIHIIVPIAAVDKVTHLRALLQLRDVA
    USA300_FPR3757  NIAIPHAYSEKHVHKTAMSMLILQEPIYMSDGTAIHIIVPIAAVDKVTHLRALLQLRDVA
                    ************************************************************

    COL             QDNDAIKRIIQSRKNSDVNEILKNYSNKEARENGWDSN
    N315            QDNDAIKRIIQSRKNSDVNEILKNYSNKEARENGWDSN
    NCTC8325        QDNDAIKRIIQSRKNSDVNEILKNYSNKEARENGWDSN
    Newman          QDNDAIKRIIQSRKNSDVNEILKNYSNKEARENGWDSN
    USA300_FPR3757  QDNDAIKRIIQSRKNSDVNEILKNYSNKEARENGWDSN
                    **************************************