From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001117000
  • symbol?:
  • description?: PTS system galactitol-specific transporter subunit IIB

      descriptions from strain specific annotations:

    • PTS system galactitol-specific transporter subunit IIB
    • PTS transport system, IIB component
    • phosphotransferase system galactitol-specific enzyme II, B component
    • phosphotransferase system, lactose/cellobiose-specific IIB subunit
    • phosphotransferase system lactose/cellobiose-specific IIB subunit
    • PTS system, sorbitol-specific IIB component
    • putative PTS transport system, IIB component
    • PTS system galactitol-specific enzyme II B component
    • PTS system, galactitol-specific IIB component
    • PTS family galactitol porter, IIB component
    • PTS system, Lactose/Cellobiose specific IIB subunit
    • PTS transport system transporter subunit IIB
    • PTS system, galactitol-specific enzyme II, B component
    • PTS system protein
    • PTS family galactitol (gat) porter component IIB
  • strand?: +
  • coordinates?: 1391928..1392165
  • synteny block?: BlockID0006370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0246
    08BA02176:
    C248_0232
    11819-97:
    MS7_0234
    71193:
    ST398NM01_0258
    ECT-R 2:
    ECTR2_207
    ED133:
    SAOV_0184
    ED98:
    SAAV_0212
    HO 5096 0412:
    SAEMRSA15_02050
    JH1:
    SaurJH1_0237
    JH9:
    SaurJH9_0231
    JKD6008:
    SAA6008_00219
    JKD6159:
    SAA6159_00223
    LGA251:
    SARLGA251_02100
    M013:
    M013TW_0227
    MRSA252:
    SAR0241
    MSHR1132:
    SAMSHR1132_02140
    MSSA476:
    SAS0222
    Mu3:
    SAHV_0245
    Mu50:
    SAV0246
    MW2:
    MW0222
    RF122:
    SAB0185
    ST398:
    SAPIG0258
    T0131:
    SAT0131_00237
    TCH60:
    HMPREF0772_10257 (gatB)
    TW20:
    SATW20_02480
    USA300_TCH1516:
    USA300HOU_0257
    VC40:
    SAVC_00970

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQVLVACGAGIATSTVVNNAIEEMAKEHNIKVDIKQIKITEVGPYEDTADLLVTTAMTK
    N315            MKQVLVACGAGIATSTVVNNAIEEMAKEHNIKVDIKQIKITEVGPYEDTADLLVTTAMTK
    NCTC8325        MKQVLVACGAGIATSTVVNNAIEEMAKEHNIKVDIKQIKITEVGPYEDTADLLVTTAMTK
    Newman          MKQVLVACGAGIATSTVVNNAIEEMAKEHNIKVDIKQIKITEVGPYEDTADLLVTTAMTK
    USA300_FPR3757  MKQVLVACGAGIATSTVVNNAIEEMAKEHNIKVDIKQIKITEVGPYEDTADLLVTTAMTK
                    ************************************************************

    COL             KEYKFPVINARNFLTGIGIEETKQQILTELQK
    N315            KEYKFPVINARNFLTGIGIEETKQQILTELQK
    NCTC8325        KEYKFPVINARNFLTGIGIEETKQQILTELQK
    Newman          KEYKFPVINARNFLTGIGIEETKQQILTELQK
    USA300_FPR3757  KEYKFPVINARNFLTGIGIEETKQQILTELQK
                    ********************************