From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001122000
  • symbol?:
  • description?: galactitol-1-phosphate 5-dehydrogenase

      descriptions from strain specific annotations:

    • galactitol-1-phosphate 5-dehydrogenase
    • hexitol dehydrogenase
    • zinc-binding dehydrogenase family oxidoreductase
    • sorbitol dehydrogenase
    • alcohol dehydrogenase
    • oxidoreductase, zinc-binding dehydrogenase family
    • pseudogene
    • putative sorbitol dehydrogenase
    • putative zinc-binding dehydrogenase
    • sorbitol dehydrogenase homologue
    • Sorbitol dehydrogenase -like protein
    • zinc (Zn2+)-binding dehydrogenase
    • zinc-binding dehydrogenase family protein
    • zinc-binding sorbitol dehydrogenase
  • strand?: +
  • coordinates?: 1394964..1396008
  • synteny block?: BlockID0006420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0250
    08BA02176:
    C248_0237
    11819-97:
    MS7_0238
    71193:
    ST398NM01_0262
    ECT-R 2:
    ECTR2_211
    ED133:
    SAOV_0189
    ED98:
    SAAV_0217
    HO 5096 0412:
    SAEMRSA15_02090
    JH1:
    SaurJH1_0241
    JH9:
    SaurJH9_0235
    JKD6008:
    SAA6008_00223
    JKD6159:
    SAA6159_00227
    LGA251:
    SARLGA251_02140
    M013:
    M013TW_0231
    MRSA252:
    SAR0245
    MSHR1132:
    SAMSHR1132_02180
    MSSA476:
    SAS0226
    Mu3:
    SAHV_0249
    Mu50:
    SAV0250
    MW2:
    MW0226
    RF122:
    SAB0189
    ST398:
    SAPIG0262
    T0131:
    SAT0131_00242
    TCH60:
    HMPREF0772_10253 (gatD)
    TW20:
    SATW20_02520
    USA300_TCH1516:
    USA300HOU_0261
    VC40:
    SAVC_00990

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKALKLYGVEDLRYEDNEKPVIESANDVIIKVRATGICGSDTSRYKKMGPYIKGMPFGHE
    N315            MKALKLYGVEDLRYEDNEKPVIESANDVIVKVRATGICGSDTSRYKKMGPYIKGMPFGHE
    NCTC8325        MKALKLYGVEDLRYEDNEKPVIESANDVIIKVRATGICGSDTSRYKKMGPYIKGMPFGHE
    Newman          MKALKLYGVEDLRYEDNEKPVIESANDVIIKVRATGICGSDTSRYKKMGPYIKGMPFGHE
    USA300_FPR3757  MKALKLYGVEDLRYEDNEKPVIESANDVIIKVRATGICGSDTSRYKKMGPYIKGMPFGHE
                    *****************************:******************************

    COL             FSGVVDAIGSDVTHVNVGDKVTGCPAIPCYQCEYCLKGEYARCEKLFVIGSYEPGSFAEY
    N315            FSGVVDAIGSDVTHVNVGDKVTGCPAIPCYQCEYCLKGEYARCEKLFVIGSYEPGSFAEY
    NCTC8325        FSGVVDAIGSDVTHVNVGDKVTGCPAIPCYQCEYCLKGEYARCEKLFVIGSYEPGSFAEY
    Newman          FSGVVDAIGSDVTHVNVGDKVTGCPAIPCYQCEYCLKGEYARCEKLFVIGSYEPGSFAEY
    USA300_FPR3757  FSGVVDAIGSDVTHVNVGDKVTGCPAIPCYQCEYCLKGEYARCEKLFVIGSYEPGSFAEY
                    ************************************************************

    COL             VKLPAQNVLKVPDNVDYIEAAMVEPSAVVAHGFYKSNIQPGMTVAVMGCGSIGLLAIQWA
    N315            VKLPAQNVLKVPDNVDYIEAAMVEPSAVVAHGFYKSNIQPGMTVAVMGCGSIGLLAIQWA
    NCTC8325        VKLPAQNVLKVPDNVDYIEAAMVEPSAVVAHGFYKSNIQPGMTVAVMGCGSIGLLAIQWA
    Newman          VKLPAQNVLKVPDNVDYIEAAMVEPSAVVAHGFYKSNIQPGMTVAVMGCGSIGLLAIQWA
    USA300_FPR3757  VKLPAQNVLKVPDNVDYIEAAMVEPSAVVAHGFYKSNIQPGMTVAVMGCGSIGLLAIQWA
                    ************************************************************

    COL             RIFGAAHIIAIDIDAHKLDIATSLGAHQTINSKEENLEKFIENHYANQIDLAIESSGAKV
    N315            RIFGAAHIIAIDIDAHKLDIATSLGAHQTINSKEENLEKFIENHYANQIDLAIESSGAKV
    NCTC8325        RIFGAAHIIAIDIDAHKLDIATSLGAHQTINSKEENLEKFIENHYANQIDLAIESSGAKV
    Newman          RIFGAAHIIAIDIDAHKLDIATSLGAHQTINSKEENLEKFIENHYANQIDLAIESSGAKV
    USA300_FPR3757  RIFGAAHIIAIDIDAHKLDIATSLGAHQTINSKEENLEKFIENHYANQIDLAIESSGAKV
                    ************************************************************

    COL             TIGQILTLPKKGGEVVLLGIPYDDIEIDRVHFEKILRNELTVCGSWNCLSSNFPGKEWTA
    N315            TIGQILTLPKKGGEVVLLGIPYDDIEIDRVHFEKILRNELTVCGSWNCLSSNFPGKEWTA
    NCTC8325        TIGQILTLPKKGGEVVLLGIPYDDIEIDRVHFEKILRNELTVCGSWNCLSSNFPGKEWTA
    Newman          TIGQILTLPKKGGEVVLLGIPYDDIEIDRVHFEKILRNELTVCGSWNCLSSNFPGKEWTA
    USA300_FPR3757  TIGQILTLPKKGGEVVLLGIPYDDIEIDRVHFEKILRNELTVCGSWNCLSSNFPGKEWTA
                    ************************************************************

    COL             TLHYMKTKDINVKPIISHFLPLEKGPETFDKLVNKKERFDKVMFTIY
    N315            TLHYMKTKDINVKPIISHFLPLEKGPETFDKLVNKKERFDKVMFTIY
    NCTC8325        TLHYMKTKDINVKPIISHFLPLEKGPETFDKLVNKKERFDKVMFTIY
    Newman          TLHYMKTKDINVKPIISHFLPLEKGPETFDKLVNKKERFDKVMFTIY
    USA300_FPR3757  TLHYMKTKDINVKPIISHFLPLEKGPETFDKLVNKKERFDKVMFTIY
                    ***********************************************