From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001126000
  • symbol?: tarL'
  • description?: tagB protein

      descriptions from strain specific annotations:

    • tagB protein
    • teichoic acid biosynthesis protein
    • CDP-glycerol glycerophosphotransferase family protein
    • teichoic acid biosynthesis protein TagB
    • putative teichoic acid biosynthesis protein B
    • glycosyl/glycerophosphate transferase
    • putative CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase
    • Putative polyribitolphosphotransferase
    • CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase
    • CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase family protein
    • CDP-ribitol ribitolphosphotransferase
    • teichoic acid biosynthesis protein, putative
    • teichoic acid biosynthesis protein B
  • strand?: +
  • coordinates?: 1398379..1400073
  • synteny block?: BlockID0006460
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0253
    08BA02176:
    C248_0240
    11819-97:
    MS7_0241
    71193:
    ST398NM01_0265
    ECT-R 2:
    ECTR2_214
    ED133:
    SAOV_0192
    ED98:
    SAAV_0221
    HO 5096 0412:
    SAEMRSA15_02120
    JH1:
    SaurJH1_0244
    JH9:
    SaurJH9_0238
    JKD6008:
    SAA6008_00226
    JKD6159:
    SAA6159_00230
    LGA251:
    SARLGA251_02170 (tarK)
    M013:
    M013TW_0234
    MRSA252:
    SAR0248
    MSHR1132:
    SAMSHR1132_02210
    MSSA476:
    SAS0229
    Mu3:
    SAHV_0252
    Mu50:
    SAV0253
    MW2:
    MW0229
    RF122:
    SAB0192
    ST398:
    SAPIG0265
    T0131:
    SAT0131_00245 (accB)
    TCH60:
    HMPREF0772_10250
    TW20:
    SATW20_02550 (tarK)
    USA300_TCH1516:
    USA300HOU_0264 (tagB1)
    VC40:
    SAVC_01005

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKTKQAIHIDNIYWERVQLYIEGHSEGVDLTSGQFVLRNLTETKTLEANEMKIDGNTFI
    N315            MTKTKQAIHIDNIYWERVQLYIEGHSEGVDLTSGQFVLRNLTETKTLEANEMKIDGNTFI
    NCTC8325        ---------------------------------------------------MKIDGNTFI
    Newman          MTKTKQAIHIDNIYWERVQLYIEGHSEGVDLTSGQFVLRNLTETKTLEANEMKIDGNTFI
    USA300_FPR3757  MTKTKQAIHIDNIYWERVQLYIEGHSEGVDLTSGQFVLRNLTETKTLEANEMKIDGNTFI
                                                                       *********

    COL             CRFNVAILDDGYYLPMDKYLFVYHDQLEYIGQLNPNIIDQAYAALNEEQIEEYNELTTQN
    N315            CRFNVAILDDGYYLPMDKYLFVYHDQLEYIGQLNPNIIDQAYAALNEEQIEEYNELTTQN
    NCTC8325        CRFNVAILDDGYYLPMDKYLFVYHDQLEYIGQLNPNIIDQAYAALNEEQIEEYNELTTQN
    Newman          CRFNVAILDDGYYLPMDKYLFVYHDQLEYIGQLNPNIIDQAYAALNEEQIEEYNELTTQN
    USA300_FPR3757  CRFNVAILDDGYYLPMDKYLFVYHDQLEYIGQLNPNIIDQAYAALNEEQIEEYNELTTQN
                    ************************************************************

    COL             GKVNYLLAYDAKVFRKGGVSQHTVYTITPEIASDVNEFVFDIEITLPQEKSGVIATSAHW
    N315            GKVNYLLAYDAKVFRKGGVSQHTVYTITPEIASDVNEFVFDIEITLPQEKSGVIATSAHW
    NCTC8325        GKVNYLLAYDAKVFRKGGVSQHTVYTITPEIASDVNEFVFDIEITLPQEKSGVIATSAHW
    Newman          GKVNYLLAYDAKVFRKGGVSQHTVYTITPEIASDVNEFVFDIEITLPQEKSGVIATSAHW
    USA300_FPR3757  GKVNYLLAYDAKVFRKGGVSQHTVYTITPEIASDVNEFVFDIEITLPQEKSGVIATSAHW
                    ************************************************************

    COL             LHKQGHKASFESRSFLFKAIFNITKLLHIKRSKTILFTSDSRPNLSGNFKYVYDELLRQK
    N315            LHKQGHKASFESRSFLFKAIFNITKLLHIKRSKTILFTSDSRPNLSGNFKYVYDELLRQK
    NCTC8325        LHKQGHKASFESRSFLFKAIFNITKLLHIKRSKTILFTSDSRPNLSGNFKYVYDELLRQK
    Newman          LHKQGHKASFESRSFLFKAIFNITKLLHIKRSKTILFTSDSRPNLSGNFKYVYDELLRQK
    USA300_FPR3757  LHKQGHKASFESRSFLFKAIFNITKLLHIKRSKTILFTSDSRPNLSGNFKYVYDELLRQK
                    ************************************************************

    COL             VDFDYDIKTVFKENITDRRKWRDKFRLPYLLGKADYIFVDDFHPLIYTVRFRPSQEIIQV
    N315            VDFDYDIKTVFKANITDRRKWRDKFRLPYLLGKADYIFVDDFHPLIYTVRFRPSQEIIQV
    NCTC8325        VDFDYDIKTVFKENITDRRKWRDKFRLPYLLGKADYIFVDDFHPLIYTVRFRPSQEIIQV
    Newman          VDFDYDIKTVFKENITDRRKWRDKFRLPYLLGKADYIFVDDFHPLIYTVRFRPSQEIIQV
    USA300_FPR3757  VDFDYDIKTVFKENITDRRKWRDKFRLPYLLGKADYIFVDDFHPLIYTVRFRPSQEIIQV
                    ************ ***********************************************

    COL             WHAVGAFKTVGFSRTGKKGGPFIDSLNHRSYTKAYVSSETDIPFYAEAFGIREENVVPTG
    N315            WHAVGAFKTVGFSRTGKKGGPFIDSLNHRSYTKAYVSSETDIPFYAEAFGIREENVVPTG
    NCTC8325        WHAVGAFKTVGFSRTGKKGGPFIDSLNHRSYTKAYVSSETDIPFYAEAFGIREENVVPTG
    Newman          WHAVGAFKTVGFSRTGKKGGPFIDSLNHRSYTKAYVSSETDIPFYAEAFGIREENVVPTG
    USA300_FPR3757  WHAVGAFKTVGFSRTGKKGGPFIDSLNHRSYTKAYVSSETDIPFYAEAFGIREENVVPTG
                    ************************************************************

    COL             VPRTDVLFDEAYATQIKQEMEDELPIIKGKKVILFAPTFRGNGHGTAHYPFFKIDFERLA
    N315            VPRTDVLFDEAYATQIKQEMEDELPIIKGKKVILFAPTFRGNGHGTAHYPFFKIDFERLA
    NCTC8325        VPRTDVLFDEAYATQIKQEMEDELPIIKGKKVILFAPTFRGNGHGTAHYPFFKIDFERLA
    Newman          VPRTDVLFDEAYATQIKQEMEDELPIIKGKKVILFAPTFRGNGHGTAHYPFFKIDFERLA
    USA300_FPR3757  VPRTDVLFDEAYATQIKQEMEDELPIIKGKKVILFAPTFRGNGHGTAHYPFFKIDFERLA
                    ************************************************************

    COL             RYCEKHNAVVLFKMHPFVKNRLNISREHRQYFIDVSDHREVNDILFVTDLLISDYSSLIY
    N315            RYCEKHNAVVLFKMHPFVKNRLNISREHRQYFIDVSDHREVNDILFVTDLLISDYSSLIY
    NCTC8325        RYCEKHNAVVLFKMHPFVKNRLNISREHRQYFIDVSDHREVNDILFVTDLLISDYSSLIY
    Newman          RYCEKHNAVVLFKMHPFVKNRLNISREHRQYFIDVSDHREVNDILFVTDLLISDYSSLIY
    USA300_FPR3757  RYCEKHNAVVLFKMHPFVKNRLNISREHRQYFIDVSDHREVNDILFVTDLLISDYSSLIY
                    ************************************************************

    COL             EYAVFKKPMIFYAFDLEDYITTRDFYEPFESFVPGKIVQSFDALMDALDNEDYEVEKVVP
    N315            EYAVFKKPMIFYAFDLEDYITTRDFYEPYESFVPGKIVQSFDALMDALDTEDYEVEKVVP
    NCTC8325        EYAVFKKPMIFYAFDLEDYITTRDFYEPFESFVPGKIVQSFDALMDALDNEDYEVEKVVP
    Newman          EYAVFKKPMIFYAFDLEDYITTRDFYEPFESFVPGKIVQSFDALMDALDNEDYEVEKVVP
    USA300_FPR3757  EYAVFKKPMIFYAFDLEDYITTRDFYEPFESFVPGKIVQSFDALMDALDNEDYEVEKVVP
                    ****************************:********************.**********

    COL             FLDKHFKYQDGRSSERLVKDLFRR
    N315            FLDKHFKYQDGRSSERLVKDLFRR
    NCTC8325        FLDKHFKYQDGRSSERLVKDLFRR
    Newman          FLDKHFKYQDGRSSERLVKDLFRR
    USA300_FPR3757  FLDKHFKYQDGRSSERLVKDLFRR
                    ************************