From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001146000
  • symbol?: bglA
  • description?: 6-phospho-beta-glucosidase

      descriptions from strain specific annotations:

    • 6-phospho-beta-glucosidase
    • glycoside hydrolase family protein
    • aryl-phospho-beta-D-glucosidase BglA
  • strand?: +
  • coordinates?: 1421411..1422850
  • synteny block?: BlockID0006660
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0251 (bglA)
    N315:
    SA0256 (bglA)
    NCTC8325:
    Newman:
    NWMN_0200 (bglA)
    USA300_FPR3757:
    04-02981:
    SA2981_0266 (bglA)
    08BA02176:
    C248_0255 (bglA)
    11819-97:
    MS7_0256 (bglA)
    71193:
    ST398NM01_0280
    ECT-R 2:
    ECTR2_227
    ED133:
    SAOV_0207
    ED98:
    SAAV_0234 (bglA)
    HO 5096 0412:
    SAEMRSA15_02260 (bglA)
    JH1:
    SaurJH1_0257
    JH9:
    SaurJH9_0251
    JKD6008:
    SAA6008_00241 (bglA)
    JKD6159:
    SAA6159_00244 (bglA)
    LGA251:
    SARLGA251_02310 (bglA)
    M013:
    M013TW_0247
    MRSA252:
    SAR0264 (bglA)
    MSHR1132:
    SAMSHR1132_02330
    MSSA476:
    SAS0243
    Mu3:
    SAHV_0265 (bglA)
    Mu50:
    SAV0266 (bglA)
    MW2:
    MW0242 (bglA)
    RF122:
    SAB0205 (bglA)
    ST398:
    SAPIG0280
    T0131:
    SAT0131_00260
    TCH60:
    HMPREF0772_10235 (bglA)
    TW20:
    SATW20_02690 (bglA)
    USA300_TCH1516:
    USA300HOU_0277 (bglA)
    VC40:
    SAVC_01070

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKLPQNFMWGGALAANQFEGGYDKGGKGLSVIDVMTSGAHGKARQITESIDPNHYYPNH
    N315            MTKLPQNFMWGGALAANQFEGGYEKGGKGLSVIDVMTSGAHGKARQITESIDLNHYYPNH
    NCTC8325        MTKLPQNFMWGGALAANQFEGGYDKGGKGLSVIDVMTSGAHGKARQITESIDPNHYYPNH
    Newman          MTKLPQNFMWGGALAANQFEGGYDKGGKGLSVIDVMTSGAHGKARQITESIDPNHYYPNH
    USA300_FPR3757  MTKLPQNFMWGGALAANQFEGGYDKGGKGLSVIDVMTSGAHGKARQITESIDPNHYYPNH
                    ***********************:**************************** *******

    COL             EGIDFYHRYKEDIALFKEMGLKCLRTSIAWTRIFPNGDEDVPNEEGLAFYDRIFDELIAQ
    N315            EGIDFYHRYKEDIALFKEMGLKCLRTSIAWTRIFPNGDEDVPNEEGLAFYDRIFDELIAQ
    NCTC8325        EGIDFYHRYKEDIALFKEMGLKCLRTSIAWTRIFPNGDEDVPNEEGLAFYDRIFDELIAQ
    Newman          EGIDFYHRYKEDIALFKEMGLKCLRTSIAWTRIFPNGDEDVPNEEGLAFYDRIFDELIAQ
    USA300_FPR3757  EGIDFYHRYKEDIALFKEMGLKCLRTSIAWTRIFPNGDEDVPNEEGLAFYDRIFDELIAQ
                    ************************************************************

    COL             GIEPVVTLSHFEMPLHLAKHYGGFRNREVVDYFVHFARVVFERYKDKVTYWMTFNEINNQ
    N315            GIEPVVTLSHFEMPLHLAKHYGGFRNREVVDYFVHFARVVFERYKDKVTYWMTFNEINNQ
    NCTC8325        GIEPVVTLSHFEMPLHLAKHYGGFRNREVVDYFVHFARVVFERYKDKVTYWMTFNEINNQ
    Newman          GIEPVVTLSHFEMPLHLAKHYGGFRNREVVDYFVHFARVVFERYKDKVTYWMTFNEINNQ
    USA300_FPR3757  GIEPVVTLSHFEMPLHLAKHYGGFRNREVVDYFVHFARVVFERYKDKVTYWMTFNEINNQ
                    ************************************************************

    COL             MDTSNPIFLWTNSGVALTENDNPEEVLYQVAHHELLASALAVRLGKEINPKFKIGTMISH
    N315            MDTSNPIFLWTNSGVALTENDNPEEVLYQVAHHELLASALAVRLGKEINPKFKIGTMISH
    NCTC8325        MDTSNPIFLWTNSGVALTENDNPEEVLYQVAHHELLASALAVRLGKEINPKFKIGTMISH
    Newman          MDTSNPIFLWTNSGVALTENDNPEEVLYQVAHHELLASALAVRLGKEINPKFKIGTMISH
    USA300_FPR3757  MDTSNPIFLWTNSGVALTENDNPEEVLYQVAHHELLASALAVRLGKEINPKFKIGTMISH
                    ************************************************************

    COL             VPIYPYSCHPKDMMEAQIANRLRFFFPDVQVRGYYPSYAKKMLARKGYDVGWQEGDDSIL
    N315            VPIYPYSCHPKDMMEAQIANRLRFFFPDVQVRGYYPSYAKKMLARKGYDVGWQEGDDSIL
    NCTC8325        VPIYPYSCHPKDMMEAQIANRLRFFFPDVQVRGYYPSYAKKMLARKGYDVGWQEGDDSIL
    Newman          VPIYPYSCHPKDMMEAQIANRLRFFFPDVQVRGYYPSYAKKMLARKGYDVGWQEGDDSIL
    USA300_FPR3757  VPIYPYSCHPKDMMEAQIANRLRFFFPDVQVRGYYPSYAKKMLARKGYDVGWQEGDDSIL
                    ************************************************************

    COL             QQGTVDYIGFSYYMSTAVKHDVDTTVENNIVNGGLNHSVENPHIATSDWGWAIDPDGLRY
    N315            QQGTVDYIGFSYYMSTAVKHDVDTTVENNIVNGGLNHSVENPHIATSDWGWAIDPDGLRY
    NCTC8325        QQGTVDYIGFSYYMSTAVKHDVDTTVENNIVNGGLNHSVENPHIATSDWGWAIDPDGLRY
    Newman          QQGTVDYIGFSYYMSTAVKHDVDTTVENNIVNGGLNHSVENPHIATSDWGWAIDPDGLRY
    USA300_FPR3757  QQGTVDYIGFSYYMSTAVKHDVDTTVENNIVNGGLNHSVENPHIATSDWGWAIDPDGLRY
                    ************************************************************

    COL             TLNVLYDRYQLPLFIVENGFGAVDEVVDGHIHDDYRIEYLKAHITAAIEAVDQDGVDLIG
    N315            TLNVLYDRYQLPLFIVENGFGAVDEVVDGHIHDDYRIEYLKAHITAAIEAVDQDGVDLIG
    NCTC8325        TLNVLYDRYQLPLFIVENGFGAVDEVVDGHIHDDYRIEYLKAHITAAIEAVDQDGVDLIG
    Newman          TLNVLYDRYQLPLFIVENGFGAVDEVVDGHIHDDYRIEYLKAHITAAIEAVDQDGVDLIG
    USA300_FPR3757  TLNVLYDRYQLPLFIVENGFGAVDEVVDGHIHDDYRIEYLKAHITAAIEAVDQDGVDLIG
                    ************************************************************

    COL             YTPWGIIDIVSFTTGEMKKRYGLIYVDRDNDGHGTMERLKKDSFYWYQQVIASNGDKL
    N315            YTPWGIIDIVSFTTGEMKKRYGLIYVDRDNDGHGTMERLKKDSFYWYQQVIASNGDKL
    NCTC8325        YTPWGIIDIVSFTTGEMKKRYGLIYVDRDNDGHGTMERLKKDSFYWYQQVIASNGDKL
    Newman          YTPWGIIDIVSFTTGEMKKRYGLIYVDRDNDGHGTMERLKKDSFYWYQQVIASNGDKL
    USA300_FPR3757  YTPWGIIDIVSFTTGEMKKRYGLIYVDRDNDGHGTMERLKKDSFYWYQQVIASNGDKL
                    **********************************************************