From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001157000
  • symbol?: rbsR
  • description?: LacI family transcriptional regulator

      descriptions from strain specific annotations:

    • LacI family transcriptional regulator
    • ribose operon repressor
    • ribose transcriptional repressor RbsR
    • putative ribose operon repressor
    • bacterial regulatory s, lacI family protein
    • LacI family regulatory protein
    • regulatory proteins, lacI family protein
    • ribose operon repressor, putative
    • ribose operon transcriptional regulator
    • sugar-binding transcriptional regulator, LacI
    • sugar-binding transcriptional regulator LacI
  • strand?: -
  • coordinates?: 1428589..1429623
  • synteny block?: BlockID0006770
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0205 (rbsR)
    USA300_FPR3757:
    04-02981:
    SA2981_0271 (rbsR)
    08BA02176:
    C248_0261
    11819-97:
    MS7_0261
    71193:
    ST398NM01_0286
    ECT-R 2:
    ECTR2_232
    ED133:
    SAOV_0212
    ED98:
    SAAV_0239
    HO 5096 0412:
    SAEMRSA15_02310
    JH1:
    SaurJH1_0262
    JH9:
    SaurJH9_0256
    JKD6008:
    SAA6008_00246 (rbsR)
    JKD6159:
    SAA6159_00250 (rbsR)
    LGA251:
    SARLGA251_02360
    M013:
    M013TW_0252
    MRSA252:
    SAR0269
    MSHR1132:
    SAMSHR1132_02380
    MSSA476:
    SAS0248
    Mu3:
    SAHV_0270
    Mu50:
    SAV0271
    MW2:
    MW0247
    RF122:
    SAB0211c
    ST398:
    SAPIG0286
    T0131:
    SAT0131_00266
    TCH60:
    HMPREF0772_10229
    TW20:
    SATW20_02740
    USA300_TCH1516:
    USA300HOU_0283
    VC40:
    SAVC_01100

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKVSIKDVAREAGVSVTTVSHILNHNDSRFSATTIKNVHAVSERLGYAPNKHAKQLRGS
    N315            MKKVSIKDVAREAGVSVTTVSHILNHNDSRFSATTIKNVHAVSERLGYAPNKHAKQLRGS
    NCTC8325        MKKVSIKDVAREAGVSVTTVSHILNHNDSRFSATTIKNVHAVSERLGYAPNKHAKQLRGS
    Newman          MKKVSIKDVAREAGVSVTTVSHILNHNDSRFSATTIKNVHAVSERLGYAPNKHAKQLRGS
    USA300_FPR3757  MKKVSIKDVAREAGVSVTTVSHILNHNDSRFSATTIKNVHAVSERLGYAPNKHAKQLRGS
                    ************************************************************

    COL             KIQTIGVILPSLTNPFFSALMQSIHDHKPSDVDLCFLTSTATDLYDNIKHLIDRGIDGLI
    N315            KIQTIGVILPSLTNPFFSALMQSIHDHKPSDVDLCFLTSTATDLYDNIKHLIDRGIDGLI
    NCTC8325        KIQTIGVILPSLTNPFFSALMQSIHDHKPSDVDLCFLTSTATDLYDNIKHLIDRGIDGLI
    Newman          KIQTIGVILPSLTNPFFSALMQSIHDHKPSDVDLCFLTSTATDLYDNIKHLIDRGIDGLI
    USA300_FPR3757  KIQTIGVILPSLTNPFFSALMQSIHDHKPSDVDLCFLTSTATDLYDNIKHLIDRGIDGLI
                    ************************************************************

    COL             IAQYISSPDALNNYLKKHHVPYVVLDQNDHQGYTDFVRTNEYQGGQLAAQHLIELGHNHM
    N315            IAQYISSPDALNNYLKKHHVPYVVLDQNDHQGYTDFVRTNEYQGGQLAAQHLIELGHNHM
    NCTC8325        IAQYISSPDALNNYLKKHHVPYVVLDQNDHQGYTDFVRTNEYQGGQLAAQHLIELGHNHM
    Newman          IAQYISSPDALNNYLKKHHVPYVVLDQNDHQGYTDFVRTNEYQGGQLAAQHLIELGHNHM
    USA300_FPR3757  IAQYISSPDALNNYLKKHHVPYVVLDQNDHQGYTDFVRTNEYQGGQLAAQHLIELGHNHM
                    ************************************************************

    COL             IIVAPYDMMANMSTRVAGFVDTLRANQLPEPQIVHTELSKRGGLTIVDDIMVQSATAIFA
    N315            IIVAPYDMMANMSTRVAGFVDTLRANQLPEPQIVHTELSKRGGLTIVDDIMVQSATAIFA
    NCTC8325        IIVAPYDMMANMSTRVAGFVDTLRANQLPEPQIVHTELSKRGGLTIVDDIMVQSATAIFA
    Newman          IIVAPYDMMANMSTRVAGFVDTLRANQLPEPQIVHTELSKRGGLTIVDDIMVQSATAIFA
    USA300_FPR3757  IIVAPYDMMANMSTRVAGFVDTLRANQLPEPQIVHTELSKRGGLTIVDDIMVQSATAIFA
                    ************************************************************

    COL             INDELAIGILRGLIEHGISIPKDISLIGYDDIDYAAYVSPPLTTVAQPITDIGKTSLTLL
    N315            INDELAIGILRGLIEHGISIPKDISLIGYDDIDYAAYVSPPLTTVAQPITDIGKTSLTLL
    NCTC8325        INDELAIGILRGLIEHGISIPKDISLIGYDDIDYAAYVSPPLTTVAQPITDIGKTSLTLL
    Newman          INDELAIGILRGLIEHGISIPKDISLIGYDDIDYAAYVSPPLTTVAQPITDIGKTSLTLL
    USA300_FPR3757  INDELAIGILRGLIEHGISIPKDISLIGYDDIDYAAYVSPPLTTVAQPITDIGKTSLTLL
                    ************************************************************

    COL             LQRLQHLDKSIDMIELPTTLKIRATTGYHLSN
    N315            LQRLQHLDKSIDMIELPTTLKIRATTGYHLSN
    NCTC8325        LQRLQHLDKSIDMIELPTTLKIRATTGYHLSN
    Newman          LQRLQHLDKSIDMIELPTTLKIRATTGYHLSN
    USA300_FPR3757  LQRLQHLDKSIDMIELPTTLKIRATTGYHLSN
                    ********************************