From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001161000
  • symbol?:
  • description?: MFS transporter

      descriptions from strain specific annotations:

    • MFS transporter
    • drug transporter
    • putative drug transporter
    • transmembrane efflux pump protein
    • drug transporter, putative
    • major facilitator superfamily protein
    • major facilitator superfamily transporter
    • major facilitator transporter
    • membrane transporter
    • MFS family major facilitator transporter
    • multidrug resistance protein B
    • putative transport protein
    • transport protein
  • strand?: -
  • coordinates?: 1431125..1432709
  • synteny block?: BlockID0006810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0274
    08BA02176:
    C248_0264
    11819-97:
    MS7_0265
    71193:
    ST398NM01_0289
    ECT-R 2:
    ECTR2_235
    ED133:
    SAOV_0215
    ED98:
    SAAV_0242
    HO 5096 0412:
    SAEMRSA15_02330
    JH1:
    SaurJH1_0265
    JH9:
    SaurJH9_0258
    JKD6008:
    SAA6008_00248
    JKD6159:
    SAA6159_00252
    LGA251:
    SARLGA251_02380
    M013:
    M013TW_0255
    MRSA252:
    SAR0271
    MSHR1132:
    SAMSHR1132_02400
    MSSA476:
    SAS0250
    Mu3:
    SAHV_0272
    Mu50:
    SAV0274
    MW2:
    MW0250
    RF122:
    SAB0213c
    ST398:
    SAPIG0289
    T0131:
    SAT0131_00269
    TCH60:
    HMPREF0772_10226
    TW20:
    SATW20_02760
    USA300_TCH1516:
    USA300HOU_0287
    VC40:
    SAVC_01115

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNTQSSPRSNIIIAIMLSALTYWLFAQSFINIGPLVGQTYQTSPAVLNLSISLTSFATG
    N315            MNNTQSSPRSNIIIAIMLSALTYWLFAQSFINIGPLVGQTYQTSPAVLNLSISLTSFATG
    NCTC8325        MNNTQSSPRSNIIIAIMLSALTYWLFAQSFINIGPLVGQTYQTSPAVLNLSISLTSFATG
    Newman          MNNTQSSPRSNIIIAIMLSALTYWLFAQSFINIGPLVGQTYQTSPAVLNLSISLTSFATG
    USA300_FPR3757  MNNTQSSPRSNIIIAIMLSALTYWLFAQSFINIGPLVGQTYQTSPAVLNLSISLTSFATG
                    ************************************************************

    COL             IFMVAAGDIADKIGQLRMTYMGLIISMFASLLLIISDITALLIIGRILQGLSAAILLPST
    N315            IFMVAAGDIADKIGQLRMTYMGLIISMFASLLLIISDITALLIIGRILQGLSAAILLPST
    NCTC8325        IFMVAAGDIADKIGQLRMTYMGLIISMFASLLLIISDITALLIIGRILQGLSAAILLPST
    Newman          IFMVAAGDIADKIGQLRMTYMGLIISMFASLLLIISDITALLIIGRILQGLSAAILLPST
    USA300_FPR3757  IFMVAAGDIADKIGQLRMTYMGLIISMFASLLLIISDITALLIIGRILQGLSAAILLPST
                    ************************************************************

    COL             VGVLNNQFKGEHLRRAISYLMISTVGGIGLAGVIGGLIASNFGWQTNFIISIVIAFIAIL
    N315            VGVLNNQFKGEHLRRAISYLMISTVGGIGLAGVIGGLIATNFGWQMNFIISIVIAFIAIL
    NCTC8325        VGVLNNQFKGEHLRRAISYLMISTVGGIGLAGVIGGLIASNFGWQTNFIISIVIAFIAIL
    Newman          VGVLNNQFKGEHLRRAISYLMISTVGGIGLAGVIGGLIASNFGWQTNFIISIVIAFIAIL
    USA300_FPR3757  VGVLNNQFKGEHLRRAISYLMISTVGGIGLAGVIGGLIASNFGWQTNFIISIVIAFIAIL
                    ***************************************:***** **************

    COL             LLKGTPEKVSQHSHRHPFDYKGMSIFAVMIGSFTLLLTQGFEQGWFSTFSIICLSIFIIT
    N315            LLKGTPEKVSQHSHRHPFDYKGMSIFAVMIGSFTLLLTQGFEQGWFSTFSFICLSIFIIT
    NCTC8325        LLKGTPEKVSQHSHRHPFDYKGMSIFAVMIGSFTLLLTQGFEQGWFSTFSIICLSIFIIT
    Newman          LLKGTPEKVSQHSHRHPFDYKGMSIFAVMIGSFTLLLTQGFEQGWFSTFSIICLSIFIIT
    USA300_FPR3757  LLKGTPEKVSQHSHRHPFDYKGMSIFAVMIGSFTLLLTQGFEQGWFSTFSIICLSIFIIT
                    **************************************************:*********

    COL             TLIFIIIERRHEVPFIDFSVLRNRPFIGAFLNNFVLNSGLGVTVVFFIYAQTHLGLSAAQ
    N315            TLIFIIIERRHEVPFIDFSVLRNRPFIGAFLNNFVLNSGLGVTVVFFIYAQTHLGLSAAQ
    NCTC8325        TLIFIIIERRHEVPFIDFSVLRNRPFIGAFLNNFVLNSGLGVTVVFFIYAQTHLGLSAAQ
    Newman          TLIFIIIERRHEVPFIDFSVLRNRPFIGAFLNNFVLNSGLGVTVVFFIYAQTHLGLSAAQ
    USA300_FPR3757  TLIFIIIERRHEVPFIDFSVLRNRPFIGAFLNNFVLNSGLGVTVVFFIYAQTHLGLSAAQ
                    ************************************************************

    COL             SGLVTLPYAIVAVAMIRLGEKATLRFGGKLMLIIGPLFPVIGITIISMTQLLASQYVIAV
    N315            SGLVTLPYAIVAVAMIRLGEKATLRFGGKLMLIIGPLFPVIGITIISMTQLSASQYVIAV
    NCTC8325        SGLVTLPYAIVAVAMIRLGEKATLRFGGKLMLIIGPLFPVIGITIISMTQLLASQYVIAV
    Newman          SGLVTLPYAIVAVAMIRLGEKATLRFGGKLMLIIGPLFPVIGITIISMTQLLASQYVIAV
    USA300_FPR3757  SGLVTLPYAIVAVAMIRLGEKATLRFGGKLMLIIGPLFPVIGITIISMTQLLASQYVIAV
                    *************************************************** ********

    COL             IIGFVICAIGNGLVATPGLTIAIFSMPNEKVGLATGLYKMSGTLGGAFGIALSTTVFSML
    N315            IIGFVICAIGNGLVATPGLTIAIFSMPNEKVGLATGLYKMSGTLGGAFGIALSTTVFSML
    NCTC8325        IIGFVICAIGNGLVATPGLTIAIFSMPNEKVGLATGLYKMSGTLGGSFGIALSTTVFSML
    Newman          IIGFVICAIGNGLVATPGLTIAIFSMPNEKVGLATGLYKMSGTLGGAFGIALSTTVFSML
    USA300_FPR3757  IIGFVICAIGNGLVATPGLTIAIFSMPNEKVGLATGLYKMSGTLGGAFGIALSTTVFSML
                    **********************************************:*************

    COL             QLNYAPSVAATVTFIVSIVLMILGSLSAYMIIPKTVKS
    N315            QLNYAPSVAATVTFIVSIVLMILGSLSAYMIIPKTVKS
    NCTC8325        QLNYAPSVAATVTFIVSIVLMILGSLSAYMIIPKTVKS
    Newman          QLNYAPSVAATVTFIVSIVLMILGSLSAYMIIPKTVKS
    USA300_FPR3757  QLNYAPSVAATVTFIVSIVLMILGSLSAYMIIPKTVKS
                    **************************************