From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001165000
  • symbol?:
  • description?: ABC-2 transporter family protein

      descriptions from strain specific annotations:

    • ABC-2 transporter family protein
    • probable membrane protein
    • ABC-2 type transport system permease
  • strand?: -
  • coordinates?: 1435965..1436885
  • synteny block?: BlockID0006850
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0278
    08BA02176:
    C248_0268
    11819-97:
    MS7_0269
    71193:
    ST398NM01_0293
    ECT-R 2:
    ECTR2_239
    ED133:
    SAOV_0219
    ED98:
    SAAV_0246
    HO 5096 0412:
    SAEMRSA15_02370
    JH1:
    SaurJH1_0269
    JH9:
    SaurJH9_0262
    JKD6008:
    SAA6008_00252
    JKD6159:
    SAA6159_00256
    LGA251:
    SARLGA251_02420
    M013:
    M013TW_0259
    MRSA252:
    SAR0275
    MSHR1132:
    SAMSHR1132_02440
    MSSA476:
    SAS0254
    Mu3:
    SAHV_0276
    Mu50:
    SAV0278
    MW2:
    MW0254
    RF122:
    SAB0217c
    ST398:
    SAPIG0293
    T0131:
    SAT0131_00273
    TCH60:
    HMPREF0772_10222
    TW20:
    SATW20_02800
    USA300_TCH1516:
    USA300HOU_0291
    VC40:
    SAVC_01135

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKPYIQLVVFKQWLQYILLVTTIVIALVLIGIGYRVAHDNFKIPITIQDLDQTTASKSFV
    N315            MKPYIQLVLFKQWLQYILLVTTIVIALVLIGIGYRVAHDNFKIPITIQDLDQTTASKSFV
    NCTC8325        MKPYIQLVVFKQWLQYILLVTTIVIALVLIGIGYRVAHDNFKIPITIQDLDQTTASKSFV
    Newman          MKPYIQLVVFKQWLQYILLVTTIVIALVLIGIGYRVAHDNFKIPITIQDLDQTTASKSFV
    USA300_FPR3757  MKPYIQLVVFKQWLQYILLVTTIVIALVLIGIGYRVAHDNFKIPITIQDLDQTTASKSFV
                    ********:***************************************************

    COL             NKIKQSDYVTIKKVDEDESYIEDDVTKKEAILSMQIPKGFSQKLKENRLKETIQLYGRDD
    N315            NKIKQSDYVTIKKVDEDESYIEDDVTKKEAILSMQIPKGFSQKLKENRLKETIQLYGRDD
    NCTC8325        NKIKQSDYVTIKKVDEDESYIEDDVTKKEAILSMQIPKGFSQKLKENRLKETIQLYGRDD
    Newman          NKIKQSDYVTIKKVDEDESYIEDDVTKKEAILSMQIPKGFSQKLKENRLKETIQLYGRDD
    USA300_FPR3757  NKIKQSDYVTIKKVDEDESYIEDDVTKKEAILSMQIPKGFSQKLKENRLKETIQLYGRDD
                    ************************************************************

    COL             FIGGIAVEIVSSSLYEQQIPNIIYEHLEDMKQHQSIDAINKSYHKHTPESKIKFVSLTKQ
    N315            FIGGIAIEIVSSSLYEQQIPNIIYEHLEDMKQHQSIDAINKSYHKHTPESKIKFVSLTKQ
    NCTC8325        FIGGIAVEIVSSSLYEQQIPNIIYEHLEDMKQHQSIDAINKSYHKHTPESKIKFVSLTKQ
    Newman          FIGGIAVEIVSSSLYEQQIPNIIYEHLEDMKQHQSIDAINKSYHKHTPESKIKFVSLTKQ
    USA300_FPR3757  FIGGIAVEIVSSSLYEQQIPNIIYEHLEDMKQHQSIDAINKSYHKHTPESKIKFVSLTKQ
                    ******:*****************************************************

    COL             AQHSISISLIFAVILFVSAVQVVLHYRLNQQAALQRLSQYHLSRFKLYSTYVMTHTILLL
    N315            AQHSISISLIFAVILFVSAVQVVLHYRLNQQAALQRLSQYHLSRFKLYSTYVMTHTILLL
    NCTC8325        AQHSISISLIFAVILFVSAVQVVLHYRLNQQAALQRLSQYHLSRFKLYSTYVMTHTILLL
    Newman          AQHSISISLIFAVILFVSAVQVVLHYRLNQQAALQRLSQYHLSRFKLYSTYVMTHTILLL
    USA300_FPR3757  AQHSISISLIFAVILFVSAVQVVLHYRLNQQAALQRLSQYHLSRFKLYSTYVMTHTILLL
                    ************************************************************

    COL             LVLLAVSLYLSQPLSLIFYLKSLLLILIYEIGIVFILFHIQTISHRLFMTFIYALAMGIV
    N315            LVLLAVSLYLSQPLSLIFYLKSLLLILIYEIGIVFILFHIQTISHRLFMTFIYALAMGIV
    NCTC8325        LVLLAVSLYLSQPLSLIFYLKSLLLILIYEIGIVFILFHIQTISHRLFMTFIYALAMGIV
    Newman          LVLLAVSLYLSQPLSLIFYLKSLLLILIYEIGIVFILFHIQTISHRLFMTFIYALAMGIV
    USA300_FPR3757  LVLLAVSLYLSQPLSLIFYLKSLLLILIYEIGIVFILFHIQTISHRLFMTFIYALAMGIV
                    ************************************************************

    COL             YLIIFM
    N315            YLIIFM
    NCTC8325        YLIIFM
    Newman          YLIIFM
    USA300_FPR3757  YLIIFM
                    ******