From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001175000
  • symbol?: esxA
  • description?: virulence factor EsxA

      descriptions from strain specific annotations:

    • virulence factor EsxA
    • ESAT-6/Esx family secreted protein EsxA/YukE
    • ESAT-6/WXG100 family secreted protein EsxA/YukE
    • proteins of 100 residues with WXG family protein
  • strand?: +
  • coordinates?: 1443218..1443562
  • synteny block?: BlockID0006940
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0282 (esxA)
    08BA02176:
    C248_0272 (esxA)
    11819-97:
    MS7_0273 (esxA)
    71193:
    ST398NM01_0297
    ECT-R 2:
    ECTR2_243
    ED133:
    SAOV_0225
    ED98:
    SAAV_0250
    HO 5096 0412:
    SAEMRSA15_02410
    JH1:
    SaurJH1_0273
    JH9:
    SaurJH9_0266
    JKD6008:
    SAA6008_00256 (esxA)
    JKD6159:
    SAA6159_00263 (esxA)
    LGA251:
    SARLGA251_02460 (esxA)
    M013:
    M013TW_0263
    MRSA252:
    SAR0279
    MSHR1132:
    SAMSHR1132_02500
    MSSA476:
    SAS0258
    Mu3:
    SAHV_0280
    Mu50:
    SAV0282
    MW2:
    MW0258
    RF122:
    SAB0223
    ST398:
    SAPIG0297
    T0131:
    SAT0131_00278
    TCH60:
    HMPREF0772_10218 (esxA)
    TW20:
    SATW20_02840 (esxA)
    USA300_TCH1516:
    USA300HOU_0297 (esxA)
    VC40:
    SAVC_01160

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSP
    N315            MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSP
    NCTC8325        MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSP
    Newman          MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSP
    USA300_FPR3757  MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSP
                    ************************************************************

    COL             KVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ
    N315            KVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ
    NCTC8325        KVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ
    Newman          KVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ
    USA300_FPR3757  KVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ
                    *************************************