From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001181000
  • symbol?: essC
  • description?: protein EssC

      descriptions from strain specific annotations:

    • protein EssC
    • diarrheal toxin
    • essC protein
    • FtsK/SpoIIIE family protein , putative secretion system component EssC/YukA
    • virulence protein EssC
    • cell division protein FtsK
    • DNA segregation ATPase and-like proteins
    • DNA segregation ATPase and related protein
    • DNA segregation ATPase-like protein
    • ftsK/SpoIIIE family protein
    • type VII secretion protein EssC
  • strand?: +
  • coordinates?: 1448716..1454080
  • synteny block?: BlockID0007000
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0276 (yukA)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0287
    08BA02176:
    C248_0277 (essC)
    11819-97:
    MS7_0278 (essC)
    71193:
    ST398NM01_0302
    ECT-R 2:
    ECTR2_248
    ED133:
    SAOV_0230 (essC)
    ED98:
    SAAV_0255 (yukA)
    HO 5096 0412:
    SAEMRSA15_02460
    JH1:
    SaurJH1_0278
    JH9:
    SaurJH9_0271
    JKD6008:
    SAA6008_00261 (yukA)
    JKD6159:
    SAA6159_00268 (yukA)
    LGA251:
    SARLGA251_02510 (essC)
    M013:
    M013TW_0268
    MRSA252:
    SAR0284
    MSHR1132:
    SAMSHR1132_02550
    MSSA476:
    SAS0263
    Mu3:
    SAHV_0285
    Mu50:
    SAV0287
    MW2:
    MW0263
    RF122:
    SAB0228
    ST398:
    SAPIG0302
    T0131:
    SAT0131_00284 (aspS)
    TCH60:
    HMPREF0772_10213 (essC)
    TW20:
    SATW20_02890 (essC)
    USA300_TCH1516:
    USA300HOU_0302 (essC)
    VC40:
    SAVC_01190

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHKLIIKYNKQLKMLNLRDGKTYTISEDERADITLKSLGEVIHLEQNNQGTWQANHTSIN
    N315            MHKLIIKYNKQLKMLNLRDGKTYTISEDERADITLKSLGEVIHLEQNNQGTWQANHTSIN
    NCTC8325        MHKLIIKYNKQLKMLNLRDGKTYTISEDERADITLKSLGEVIHLEQNNQGTWQANHTSIN
    Newman          MHKLIIKYNKQLKMLNLRDGKTYTISEDERADITLKSLGEVIHLEQNNQGTWQANHTSIN
    USA300_FPR3757  MHKLIIKYNKQLKMLNLRDGKTYTISEDERADITLKSLGEVIHLEQNNQGTWQANHTSIN
                    ************************************************************

    COL             KVLVRKGDLDDITLQLYTEADYASFAYPSIQDTMTIGPNAYDDMVIQSLMNAIIIKDFQS
    N315            KVLVRKGDLDDITLQLYTEADYASFAYPSIQDTMTIGPNAYDDMVIQSLMNAIIIKDFQS
    NCTC8325        KVLVRKGDLDDITLQLYTEADYASFAYPSIQDTMTIGPNAYDDMVIQSLMNAIIIKDFQS
    Newman          KVLVRKGDLDDITLQLYTEADYASFAYPSIQDTMTIGPNAYDDMVIQSLMNAIIIKDFQS
    USA300_FPR3757  KVLVRKGDLDDITLQLYTEADYASFAYPSIQDTMTIGPNAYDDMVIQSLMNAIIIKDFQS
                    ************************************************************

    COL             IQESQYVRIVHDKNTDVYINYELQEQLTNKAYIGDHIYVEGIWLEVQADGLNVLSQNTVA
    N315            IQESQYVRIVHDKNTDVYINYELQEQLTNKAYIGDHIYVEGIWLEVQADGLNVLSQNTVA
    NCTC8325        IQESQYVRIVHDKNTDVYINYELQEQLTNKAYIGDHIYVEGIWLEVQADGLNVLSQNTVA
    Newman          IQESQYVRIVHDKNTDVYINYELQEQLTNKAYIGDHIYVEGIWLEVQADGLNVLSQNTVA
    USA300_FPR3757  IQESQYVRIVHDKNTDVYINYELQEQLTNKAYIGDHIYVEGIWLEVQADGLNVLSQNTVA
                    ************************************************************

    COL             SSLIRLTQEMPHAQADDYNTYHRSPRIIHREPTDDIKIERPPQPIQKNNTVIWRSIIPPL
    N315            SSLIRLTQEMPHAQADDYNTYHRSPRIIHREPTDDIKIERPPQPIQKNNTVIWRSIIPPL
    NCTC8325        SSLIRLTQEMPHAQADDYNTYHRSPRIIHREPTDDIKIERPPQPIQKNNTVIWRSIIPPL
    Newman          SSLIRLTQEMPHAQADDYNTYHRSPRIIHREPTDDIKIERPPQPIQKNNTVIWRSIIPPL
    USA300_FPR3757  SSLIRLTQEMPHAQADDYNTYHRSPRIIHREPTDDIKIERPPQPIQKNNTVIWRSIIPPL
                    ************************************************************

    COL             VMIALTVVIFLVRPIGIYILMMIGMSTVTIVFGITTYFSEKKKYNKDVEKREKDYKAYLD
    N315            VMIALTVVIFLVRPIGIYILMMIGMSTVTIVFGITTYFSEKKKYNKDVEKREKDYKAYLD
    NCTC8325        VMIALTVVIFLVRPIGIYILMMIGMSTVTIVFGITTYFSEKKKYNKDVEKREKDYKAYLD
    Newman          VMIALTVVIFLVRPIGIYILMMIGMSTVTIVFGITTYFSEKKKYNKDVEKREKDYKAYLD
    USA300_FPR3757  VMIALTVVIFLVRPIGIYILMMIGMSTVTIVFGITTYFSEKKKYNKDVEKREKDYKAYLD
                    ************************************************************

    COL             NKSKEINKAIKAQRFSLNYHYPTVAEIKDIVETKAPRIYEKTSHHHDFLHYKLGIANVEK
    N315            NKSKEINKAIKAQRFSLNYHYPTVAEIKDIVETKAPRIYEKTSHHHDFLHYKLGIANVEK
    NCTC8325        NKSKEINKAIKAQRFSLNYHYPTVAEIKDIVETKAPRIYEKTSHHHDFLHYKLGIANVEK
    Newman          NKSKEINKAIKAQRFSLNYHYPTVAEIKDIVETKAPRIYEKTSHHHDFLHYKLGIANVEK
    USA300_FPR3757  NKSKEINKAIKAQRFSLNYHYPTVAEIKDIVETKAPRIYEKTSHHHDFLHYKLGIANVEK
                    ************************************************************

    COL             SFKLDYQEEEFNQRRDELFDDAKELYEFYTDVEQAPLINDLNHGPIAYIGARHLILEELE
    N315            SFKLDYQEEEFNQRRDELFDDAKELYEFYTDVEQAPLINDLNHGPIAYIGARHLILEELE
    NCTC8325        SFKLDYQEEEFNQRRDELFDDAKELYEFYTDVEQAPLINDLNHGPIAYIGARHLILEELE
    Newman          SFKLDYQEEEFNQRRDELFDDAKELYEFYTDVEQAPLINDLNHGPIAYIGARHLILEELE
    USA300_FPR3757  SFKLDYQEEEFNQRRDELFDDAKELYEFYTDVEQAPLINDLNHGPIAYIGARHLILEELE
                    ************************************************************

    COL             KMLIQLSTFHSYHDLEFLFVTREDEVETLKWARWLPHMTLRGQNIRGFVYNQRTRDQILT
    N315            KMLIQLSTFHSYHDLEFLFVTREDEVETLKWARWLPHMTLRGQNIRGFVYNQRTRDQILT
    NCTC8325        KMLIQLSTFHSYHDLEFLFVTREDEVETLKWARWLPHMTLRGQNIRGFVYNQRTRDQILT
    Newman          KMLIQLSTFHSYHDLEFLFVTREDEVETLKWARWLPHMTLRGQNIRGFVYNQRTRDQILT
    USA300_FPR3757  KMLIQLSTFHSYHDLEFLFVTREDEVETLKWARWLPHMTLRGQNIRGFVYNQRTRDQILT
                    ************************************************************

    COL             SIYSMIKERIQAVRERSRSNEQIIFTPQLVFVITDMSLIIDHVILEYVNQDLSEYGISLI
    N315            SIYSMIKERIQAVRERSRSNEQIIFTPQLVFVITDMSLIIDHVILEYVNQDLSEYGISLI
    NCTC8325        SIYSMIKERIQAVRERSRSNEQIIFTPQLVFVITDMSLIIDHVILEYVNQDLSEYGISLI
    Newman          SIYSMIKERIQAVRERSRSNEQIIFTPQLVFVITDMSLIIDHVILEYVNQDLSEYGISLI
    USA300_FPR3757  SIYSMIKERIQAVRERSRSNEQIIFTPQLVFVITDMSLIIDHVILEYVNQDLSEYGISLI
                    ************************************************************

    COL             FVEDVIESLPEHVDTIIDIKSRTEGELITKEKELVQLKFTPENIDNVDKEYIARRLANLI
    N315            FVEDVIESLPEHVDTIIDIKSRTEGELITKEKELVQLKFTPENIDNVDKEYIARRLANLI
    NCTC8325        FVEDVIESLPEHVDTIIDIKSRTEGELITKEKELVQLKFTPENIDNVDKEYIARRLANLI
    Newman          FVEDVIESLPEHVDTIIDIKSRTEGELITKEKELVQLKFTPENIDNVDKEYIARRLANLI
    USA300_FPR3757  FVEDVIESLPEHVDTIIDIKSRTEGELITKEKELVQLKFTPENIDNVDKEYIARRLANLI
                    ************************************************************

    COL             HVEHLKNAIPDSITFLEMYNVKEVDQLDVVNRWRQNETYKTMAVPLGVRGKDDILSLNLH
    N315            HVEHLKNAIPDSITFLEMYNVKEVDQLDVVNRWRQNETYKTMAVPLGVRGKDDILSLNLH
    NCTC8325        HVEHLKNAIPDSITFLEMYNVKEVDQLDVVNRWRQNETYKTMAVPLGVRGKDDILSLNLH
    Newman          HVEHLKNAIPDSITFLEMYNVKEVDQLDVVNRWRQNETYKTMAVPLGVRGKDDILSLNLH
    USA300_FPR3757  HVEHLKNAIPDSITFLEMYNVKEVDQLDVVNRWRQNETYKTMAVPLGVRGKDDILSLNLH
                    ************************************************************

    COL             EKAHGPHGLVAGTTGSGKSEIIQSYILSLAINFHPHEVAFLLIDYKGGGMANLFKDLVHL
    N315            EKAHGPHGLVAGTTGSGKSEIIQSYILSLAINFHPHEVAFLLIDYKGGGMANLFKDLVHL
    NCTC8325        EKAHGPHGLVAGTTGSGKSEIIQSYILSLAINFHPHEVAFLLIDYKGGGMANLFKDLVHL
    Newman          EKAHGPHGLVAGTTGSGKSEIIQSYILSLAINFHPHEVAFLLIDYKGGGMANLFKDLVHL
    USA300_FPR3757  EKAHGPHGLVAGTTGSGKSEIIQSYILSLAINFHPHEVAFLLIDYKGGGMANLFKDLVHL
                    ************************************************************

    COL             VGTITNLDGDEAMRALTSIKAELRKRQRLFGEHDVNHINQYHKLFKEGIATEPMPHLFII
    N315            VGTITNLDGDEAMRALTSIKAELRKRQRLFGEHDVNHINQYHKLFKEGVATEPMPHLFII
    NCTC8325        VGTITNLDGDEAMRALTSIKAELRKRQRLFGEHDVNHINQYHKLFKEGIATEPMPHLFII
    Newman          VGTITNLDGDEAMRALTSIKAELRKRQRLFGEHDVNHINQYHKLFKEGIATEPMPHLFII
    USA300_FPR3757  VGTITNLDGDEAMRALTSIKAELRKRQRLFGEHDVNHINQYHKLFKEGIATEPMPHLFII
                    ************************************************:***********

    COL             SDEFAELKSEQPDFMKELVSTARIGRSLGIHLILATQKPSGVVDDQIWSNSKFKLALKVQ
    N315            SDEFAELKSEQPDFMKELVSTARIGRSLGIHLILATQKPSGVVDDQIWSNSKFKLALKVQ
    NCTC8325        SDEFAELKSEQPDFMKELVSTARIGRSLGIHLILATQKPSGVVDDQIWSNSKFKLALKVQ
    Newman          SDEFAELKSEQPDFMKELVSTARIGRSLGIHLILATQKPSGVVDDQIWSNSKFKLALKVQ
    USA300_FPR3757  SDEFAELKSEQPDFMKELVSTARIGRSLGIHLILATQKPSGVVDDQIWSNSKFKLALKVQ
                    ************************************************************

    COL             DRQDSNEILKTPDAADITLPGRAYLQVGNNEIYELFQSAWSGATYDIEGDKLEVEDKTIY
    N315            DRQDSNEILKTPDAADITLPGRAYLQVGNNEIYELFQSAWSGATYDIEGDKLEVEDKTIY
    NCTC8325        DRQDSNEILKTPDAADITLPGRAYLQVGNNEIYELFQSAWSGATYDIEGDKLEVEDKTIY
    Newman          DRQDSNEILKTPDAADITLPGRAYLQVGNNEIYELFQSAWSGATYDIEGDKLEVEDKTIY
    USA300_FPR3757  DRQDSNEILKTPDAADITLPGRAYLQVGNNEIYELFQSAWSGATYDIEGDKLEVEDKTIY
                    ************************************************************

    COL             MINDYGQLQAINKDLSGLEDEETKENQTELEAVIDHIESITTRLEIEEVKRPWLPPLPEN
    N315            MINDYGQLQAINKDLSGLEDEETKENQTELEAVIDHIESITTRLEIEEVKRPWLPPLPEN
    NCTC8325        MINDYGQLQAINKDLSGLEDEETKENQTELEAVIDHIESITTRLEIEEVKRPWLPPLPEN
    Newman          MINDYGQLQAINKDLSGLEDEETKENQTELEAVIDHIESITTRLEIEEVKRPWLPPLPEN
    USA300_FPR3757  MINDYGQLQAINKDLSGLEDEETKENQTELEAVIDHIESITTRLEIEEVKRPWLPPLPEN
                    ************************************************************

    COL             VYQEDLVETDFRKLWSDDAKEVELTLGLKDVPEEQYQGPMVLQLKKAGHIALIGSPGYGR
    N315            VYQEDLVETDFRKLWSDDAKEVELTLGLKDVPEEQYQGPMVLQLKKAGHIALIGSPGYGR
    NCTC8325        VYQEDLVETDFRKLWSDDAKEVELTLGLKDVPEEQYQGPMVLQLKKAGHIALIGSPGYGR
    Newman          VYQEDLVETDFRKLWSDDAKEVELTLGLKDVPEEQYQGPMVLQLKKAGHIALIGSPGYGR
    USA300_FPR3757  VYQEDLVETDFRKLWSDDAKEVELTLGLKDVPEEQYQGPMVLQLKKAGHIALIGSPGYGR
                    ************************************************************

    COL             TTFLHNIIFDVARHHRPDQAHMYLFDFGTNGLMPVTDIPHVADYFTVDQEDKIAKAIRIF
    N315            TTFLHNIIFDVARHHRPDQAHMYLFDFGTNGLMPVTDIPHVADYFTVDQEDKIAKAIRIF
    NCTC8325        TTFLHNIIFDVARHHRPDQAHMYLFDFGTNGLMPVTDIPHVADYFTVDQEDKIAKAIRIF
    Newman          TTFLHNIIFDVARHHRPDQAHMYLFDFGTNGLMPVTDIPHVADYFTVDQEDKIAKAIRIF
    USA300_FPR3757  TTFLHNIIFDVARHHRPDQAHMYLFDFGTNGLMPVTDIPHVADYFTVDQEDKIAKAIRIF
                    ************************************************************

    COL             NDEIDRRKKILSQYRVTSISEYRKLTGETIPHVFILIDNFDAVKDSPFQEVFENMMIKMT
    N315            NDEIDRRKKILSQYRVTSISEYRKLTGETIPYVFILIDNFDAVKDSPFQEVFENMMIKMT
    NCTC8325        NDEIDRRKKILSQYRVTSISEYRKLTGETIPHVFILIDNFDAVKDSPFQEVFENMMIKMT
    Newman          NDEIDRRKKILSQYRVTSISEYRKLTGETIPHVFILIDNFDAVKDSPFQEVFENMMIKMT
    USA300_FPR3757  NDEIDRRKKILSQYRVTSISEYRKLTGETIPHVFILIDNFDAVKDSPFQEVFENMMIKMT
                    *******************************:****************************

    COL             REGLALDMQVTLTASRANAMKTPMYINMKTRIAMFLYDKSEVSNVVGQQKFAVKDVVGRA
    N315            REGLALDMQVTLTASRANAMKTPMYINMKTRIAMFLYDKSEVSNVVGQQKFAVKDVVGRA
    NCTC8325        REGLALDMQVTLTASRANAMKTPMYINMKTRIAMFLYDKSEVSNVVGQQKFAVKDVVGRA
    Newman          REGLALDMQVTLTASRANAMKTPMYINMKTRIAMFLYDKSEVSNVVGQQKFAVKDVVGRA
    USA300_FPR3757  REGLALDMQVTLTASRANAMKTPMYINMKTRIAMFLYDKSEVSNVVGQQKFAVKDVVGRA
                    ************************************************************

    COL             LLSSDDNVSFHIGQPFKHDETKSYNDQINDEVSAMTEFYKGETPNDIPMMPDEIKYEDYR
    N315            LLSSDDNVSFHIGQPFKHDETKSYNDQINDEVSAMTEFYKGETPNDIPMMPDEIKYEDYR
    NCTC8325        LLSSDDNVSFHIGQPFKHDETKSYNDQINDEVSAMTEFYKGETPNDIPMMPDEIKYEDYR
    Newman          LLSSDDNVSFHIGQPFKHDETKSYNDQINDEVSAMTEFYKGETPNDIPMMPDEIKYEDYR
    USA300_FPR3757  LLSSDDNVSFHIGQPFKHDETKSYNDQINDEVSAMTEFYKGETPNDIPMMPDEIKYEDYR
                    ************************************************************

    COL             ESLNLPDIVANGALPIGLDYEGVTLQKIKLTEPAMISSENPREIAHIAEIMMKEIDILNE
    N315            ESLSLPDIVANGALPIGLDYEGVTLQKIKLTEPAMISSENPREIAHIAEIMMKEIDILNE
    NCTC8325        ESLNLPDIVANGALPIGLDYEGVTLQKIKLTEPAMISSENPREIAHIAEIMMKEIDILNE
    Newman          ESLNLPDIVANGALPIGLDYEGVTLQKIKLTEPAMISSENPREIAHIAEIMMKEIDILNE
    USA300_FPR3757  ESLNLPDIVANGALPIGLDYEGVTLQKIKLTEPAMISSENPREIAHIAEIMMKEIDILNE
                    ***.********************************************************

    COL             KYAICIADSSGEFKAYRHQVANFAEEREDIKAIHQLMIEDLKQREMDGPFEKDSLYIIND
    N315            KYAICIADSSGEFKAYRHQVANFAEEREDIKAIHQLMIEDLKQREMDGPFEKDSLYIIND
    NCTC8325        KYAICIADSSGEFKAYRHQVANFAEEREDIKAIHQLMIEDLKQREMDGPFEKDSLYIIND
    Newman          KYAICIADSSGEFKAYRHQVANFAEEREDIKAIHQLMIEDLKQREMDGPFEKDSLYIIND
    USA300_FPR3757  KYAICIADSSGEFKAYRHQVANFAEEREDIKAIHQLMIEDLKQREMDGPFEKDSLYIIND
                    ************************************************************

    COL             FKTFIDCTYIPEDDVKKLITKGPELGLNILFVGIHKELIDAYDKQIDVARKMINQFSIGI
    N315            FKTYIDCTYIPEDDVKKLITKGPELGLNILFVGIHKELIDAYDKQIDVARKMINQFSIGI
    NCTC8325        FKTFIDCTYIPEDDVKKLITKGPELGLNILFVGIHKELIDAYDKQIDVARKMINQFSIGI
    Newman          FKTFIDCTYIPEDDVKKLITKGPELGLNILFVGIHKELIDAYDKQIDVARKMINQFSIGI
    USA300_FPR3757  FKTFIDCTYIPEDDVKKLITKGPELGLNILFVGIHKELIDAYDKQIDVARKMINQFSIGI
                    ***:********************************************************

    COL             RISDQQFFKFRFIQREPVIKENEAYMVANQAYQKIRWFK
    N315            RISDQQFFKFRFIQREPVIKENEAYMVANQAYQKIRWFK
    NCTC8325        RISDQQFFKFRFIQREPVIKENEAYMVANQAYQKIRWFK
    Newman          RISDQQFFKFRFIQREPVIKENEAYMVANQAYQKIRWFK
    USA300_FPR3757  RISDQQFFKFRFIQREPVIKENEAYMVANQAYQKIRWFK
                    ***************************************