From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001230000
  • symbol?:
  • description?: ABC transporter permease

      descriptions from strain specific annotations:

    • ABC transporter permease
    • ABC transporter permease protein
    • permease family protein
    • ABC transporter, permease protein
    • ftsX-like permease family protein
    • ABC transporter ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, membrane protein
  • strand?: +
  • coordinates?: 1515810..1516859
  • synteny block?: BlockID0007410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0307
    08BA02176:
    C248_0296
    11819-97:
    MS7_0298
    71193:
    ST398NM01_0321
    ECT-R 2:
    ECTR2_268
    ED133:
    SAOV_0261
    ED98:
    SAAV_0275
    HO 5096 0412:
    SAEMRSA15_02640
    JH1:
    SaurJH1_0298
    JH9:
    SaurJH9_0291
    JKD6008:
    SAA6008_00284
    JKD6159:
    SAA6159_00284
    LGA251:
    SARLGA251_02700
    M013:
    M013TW_0289
    MRSA252:
    SAR0305
    MSHR1132:
    SAMSHR1132_02820
    MSSA476:
    SAS0285
    Mu3:
    SAHV_0305
    Mu50:
    SAV0308
    MW2:
    MW0285
    RF122:
    SAB0245
    ST398:
    SAPIG0321
    T0131:
    SAT0131_00311
    TCH60:
    HMPREF0772_10187
    TW20:
    SATW20_03130
    USA300_TCH1516:
    USA300HOU_0328
    VC40:
    SAVC_01290

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFLAWNEIRRNKLKFGLIIGVLTMISYLLFLLSGLANGLINMNKEGIDKWQADAIVLNKD
    N315            MFLAWNEIRRNKLKFGLIIGVLTMISYLLFLLSGLANGLINMNKEGIDKWQADAIVLNKD
    NCTC8325        MFLAWNEIRRNKLKFGLIIGVLTMISYLLFLLSGLANGLINMNKEGIDKWQADAIVLNKD
    Newman          MFLAWNEIRRNKLKFGLIIGVLTMISYLLFLLSGLANGLINMNKEGIDKWQADAIVLNKD
    USA300_FPR3757  MFLAWNEIRRNKLKFGLIIGVLTMISYLLFLLSGLANGLINMNKEGIDKWQADAIVLNKD
                    ************************************************************

    COL             ANQTVQQSVFNKKDIENKYKKQATLKQTGEIVSNGHQKDNVLVFGVEKSSFLVPSLIEGH
    N315            ANQTVQQSVFNKKDIENKYKKQATLKQTGEIVSNGHQKDNVLVFGVEKSSFLVPSLIEGH
    NCTC8325        ANQTVQQSVFNKKDIENKYKKQATLKQTGEIVSNGHQKDNVLVFGVEKSSFLVPSLIEGH
    Newman          ANQTVQQSVFNKKDIENKYKKQATLKQTGEIVSNGHQKDNVLVFGVEKSSFLVPSLIEGH
    USA300_FPR3757  ANQTVQQSVFNKKDIENKYKKQATLKQTGEIVSNGHQKDNVLVFGVEKSSFLVPSLIEGH
                    ************************************************************

    COL             KATKDNEVLADETLKNKGFKIGDTLSLSQSDEKLHIVGFTESAKYNASSVIFTNDATIAK
    N315            KATKDNEVLADETLKNKGFKIGDTLSLSQSDEKLHIVGFTESAKYNASPVIFTNDATIAK
    NCTC8325        KATKDNEVLADETLKNKGFKIGDTLSLSQSDEKLHIVGFTESAKYNASSVIFTNDATIAK
    Newman          KATKDNEVLADETLKNKGFKIGDTLSLSQSDEKLHIVGFTESAKYNASSVIFTNDATIAK
    USA300_FPR3757  KATKDNEVLADETLKNKGFKIGDTLSLSQSDEKLHIVGFTESAKYNASSVIFTNDATIAK
                    ************************************************.***********

    COL             INPRLTGDKINAVVVRDTNWKDKKLNQELEAVSINDFIENLPGYKPQNLTLNFMISFLFV
    N315            INPRLTGDKINAVVVRDTNWKDKKLNQELEAVSINDFIENLPGYKPQNLTLNFMISFLFV
    NCTC8325        INPRLTGDKINAVVVRDTNWKDKKLNQELEAVSINDFIENLPGYKPQNLTLNFMISFLFV
    Newman          INPRLTGDKINAVVVRDTNWKDKKLNQELEAVSINDFIENLPGYKPQNLTLNFMISFLFV
    USA300_FPR3757  INPRLTGDKINAVVVRDTNWKDKKLNQELEAVSINDFIENLPGYKPQNLTLNFMISFLFV
                    ************************************************************

    COL             ISATVIGIFLYVMTLQKTSLFGILKAQGFTNGYLANVVISQTVILALFGTAFGLLLTGVT
    N315            ISATVIGIFLYVMTLQKTSLFGILKAQGFTNGYLANVVISQTLILALFGTAFGLLLTGVT
    NCTC8325        ISATVIGIFLYVMTLQKTSLFGILKAQGFTNGYLANVVISQTVILALFGTAFGLLLTGVT
    Newman          ISATVIGIFLYVMTLQKTSLFGILKAQGFTNGYLANVVISQTVILALFGTAFGLLLTGVT
    USA300_FPR3757  ISATVIGIFLYVMTLQKTSLFGILKAQGFTNGYLANVVISQTVILALFGTAFGLLLTGVT
                    ******************************************:*****************

    COL             GAFLPDAVPVKFDVLTLLVFAIVLMIVSVLGSLFSILTIRKIDPLKAIG
    N315            GAFLPDAVPVKFDVLTLLVFAIVLMIVSVLGSLFSILTIRKIDPLKAIG
    NCTC8325        GAFLPDAVPVKFDVLTLLVFAIVLMIVSVLGSLFSILTIRKIDPLKAIG
    Newman          GAFLPDAVPVKFDVLTLLVFAIVLMIVSVLGSLFSILTIRKIDPLKAIG
    USA300_FPR3757  GAFLPDAVPVKFDVLTLLVFAIVLMIVSVLGSLFSILTIRKIDPLKAIG
                    *************************************************