From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001233000
  • symbol?:
  • description?: PTS sugar transporter subunit IIC

      descriptions from strain specific annotations:

    • PTS sugar transporter subunit IIC
    • perfringolysin O regulator protein
    • transcriptional regulator
    • Perfringolysin O regulator protein PfoR
    • perfringolysin O regulatory protein
    • PfoR family transcriptional regulator
    • phosphotransferase system fructose-specific IIC component-like protein
    • Regulatory protein
    • regulatory protein PfoR
  • strand?: +
  • coordinates?: 1517751..1518788
  • synteny block?: BlockID0007440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0307 (pfoR)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0309 (pfoR)
    08BA02176:
    C248_0299 (pfoR)
    11819-97:
    MS7_0300
    71193:
    ST398NM01_0323
    ECT-R 2:
    ECTR2_270
    ED133:
    SAOV_0263
    ED98:
    SAAV_0277 (pfoR)
    HO 5096 0412:
    SAEMRSA15_02660
    JH1:
    SaurJH1_0300
    JH9:
    SaurJH9_0293
    JKD6008:
    SAA6008_00286
    JKD6159:
    SAA6159_00286
    LGA251:
    SARLGA251_02720
    M013:
    M013TW_0291
    MRSA252:
    SAR0307
    MSHR1132:
    SAMSHR1132_02840
    MSSA476:
    SAS0287
    Mu3:
    SAHV_0307
    Mu50:
    SAV0310
    MW2:
    MW0287
    RF122:
    SAB0247
    ST398:
    SAPIG0323
    T0131:
    SAT0131_00314
    TCH60:
    HMPREF0772_10185 (pfoR)
    TW20:
    SATW20_03150
    USA300_TCH1516:
    USA300HOU_0330
    VC40:
    SAVC_01300

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MDLLIGTLFLFLVLVIFTLFTYKAPNGMRAMGALANAAIATFLVEAFNKYVGGEVFGI
    N315            --MDLMIGTLFLFLVLVIFTLFTYKAPNGMRAMGALANAAIATFLVEAFNKYVGGEVFGI
    NCTC8325        -----------------------------MRAMGALANAAIATFLVEAFNKYVGGEVFGI
    Newman          MVMDLLIGTLFLFLVLVIFTLFTYKAPNGMRAMGALANAAIATFLVEAFNKYVGGEVFGI
    USA300_FPR3757  --MDLLIGTLFLFLVLVIFTLFTYKAPNGMRAMGALANAAIATFLVEAFNKYVGGEVFGI
                                                 *******************************

    COL             KFLEELGDAAGGLGGVAAAGLTALAIGVSPVYALVIAAACGGMDLLPGFFAGYMIGYVMK
    N315            KFLEELGDAAGGLGGVAAAGLTALAIGVSPVYALVIAAACGGMDLLPGFFAGYMIGYVMK
    NCTC8325        KFLEELGDAAGGLGGVAAAGLTALAIGVSPVYALVIAAACGGMDLLPGFFAGYMIGYVMK
    Newman          KFLEELGDAAGGLGGVAAAGLTALAIGVSPVYALVIAAACGGMDLLPGFFAGYMIGYVMK
    USA300_FPR3757  KFLEELGDAAGGLGGVAAAGLTALAIGVSPVYALVIAAACGGMDLLPGFFAGYMIGYVMK
                    ************************************************************

    COL             YTEKYVPDGVDLIGSIVILAPLARLIAVLLTPVVNSTLIRIGDIIQSSTNTNPIIMGIIL
    N315            YTEKYVPDGVDLIGSIVILAPLARLIAVLLTPVVNSTLIRIGDIIQSSTNTNPIIMGIIL
    NCTC8325        YTEKYVPDGVDLIGSIVILAPLARLIAVLLTPVVNSTLIRIGDIIQSSTNTNPIIMGIIL
    Newman          YTEKYVPDGVDLIGSIVILAPLARLIAVLLTPVVNSTLIRIGDIIQSSTNTNPIIMGIIL
    USA300_FPR3757  YTEKYVPDGVDLIGSIVILAPLARLIAVLLTPVVNSTLIRIGDIIQSSTNTNPIIMGIIL
                    ************************************************************

    COL             GGIITVVGTAPLSSMALTALLGLTGVPMAIGAMAAFSSAFMNGTLFHRLKLGDRKSTIAV
    N315            GGIITVVGTAPLSSMALTALLGLTGVPMAIGAMAAFSSAFMNGTLFHRLKLGDRKSTIAV
    NCTC8325        GGIITVVGTAPLSSMALTALLGLTGVPMAIGAMAAFSSAFMNGTLFHRLKLGDRKSTIAV
    Newman          GGIITVVGTAPLSSMALTALLGLTGVPMAIGAMAAFSSAFMNGTLFHRLKLGDRKSTIAV
    USA300_FPR3757  GGIITVVGTAPLSSMALTALLGLTGVPMAIGAMAAFSSAFMNGTLFHRLKLGDRKSTIAV
                    ************************************************************

    COL             SIEPLSQADIVSANPIPIYITNFFGGAIAGLIIAMSGLINDATGTATPIAGFLVMFGFNH
    N315            SIEPLSQADIVSANPIPIYITNFFGGAIAGLIIAMSGLINDATGTATPIAGFLVMFGFNH
    NCTC8325        SIEPLSQADIVSANPIPIYITNFFGGAIAGLIIAMSGLINDATGTATPIAGFLVMFGFNH
    Newman          SIEPLSQADIVSANPIPIYITNFFGGAIAGLIIAMSGLINDATGTATPIAGFLVMFGFNH
    USA300_FPR3757  SIEPLSQADIVSANPIPIYITNFFGGAIAGLIIAMSGLINDATGTATPIAGFLVMFGFNH
                    ************************************************************

    COL             PTTIVIYGVVMAIVGALAGYLGSIVFKKYPIVTKQDMINRGAVDA
    N315            PMTIVIYGVVMAIVGALAGYLGSIVFKKYPIVTKQDMINRGAVDA
    NCTC8325        PTTIVIYGVVMAIVGALAGYLGSIVFKKYPIVTKQDMINRGAVDA
    Newman          PTTIVIYGVVMAIVGALAGYLGSIVFKKYPIVTKQDMINRGAVDA
    USA300_FPR3757  PTTIVIYGVVMAIVGALAGYLGSIVFKKYPIVTKQDMINRGAVDA
                    * *******************************************