From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001236000
  • symbol?: psuG
  • description?: pseudouridine-5'-phosphate glycosidase

      descriptions from strain specific annotations:

    • pseudouridine-5'-phosphate glycosidase
    • indigoidine synthase A family protein
    • indigoidine synthase A like family protein
    • Pseudouridine kinase
  • strand?: +
  • coordinates?: 1520231..1521154
  • synteny block?: BlockID0007470
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0311
    08BA02176:
    C248_0301
    11819-97:
    MS7_0302
    71193:
    ST398NM01_0325
    ECT-R 2:
    ECTR2_272
    ED133:
    SAOV_0265
    ED98:
    SAAV_0279
    HO 5096 0412:
    SAEMRSA15_02680
    JH1:
    SaurJH1_0302
    JH9:
    SaurJH9_0295
    JKD6008:
    SAA6008_00288
    JKD6159:
    SAA6159_00288
    LGA251:
    SARLGA251_02740
    M013:
    M013TW_0293
    MRSA252:
    SAR0309
    MSHR1132:
    SAMSHR1132_02860
    MSSA476:
    SAS0289
    Mu3:
    SAHV_0309
    Mu50:
    SAV0312
    MW2:
    MW0289
    RF122:
    SAB0249
    ST398:
    SAPIG0325
    T0131:
    SAT0131_00316
    TCH60:
    HMPREF0772_10183
    TW20:
    SATW20_03170
    USA300_TCH1516:
    USA300HOU_0332
    VC40:
    SAVC_01310

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MANLQKYIEYSREVQQARENNQPIVALESTIISHGMPYPQNVEMATTVEQIIRNNGAIPA
    N315            MANLQKYIEYSREVQQARENNQPIVALESTIISHGMPYPQNVEMATTVEQIIRNNGAIPA
    NCTC8325        MANLQKYIEYSREVQQARENNQPIVALESTIISHGMPYPQNVEMATTVEQIIRNNGAIPA
    Newman          MANLQKYIEYSREVQQARENNQPIVALESTIISHGMPYPQNVEMATTVEQIIRNNGAIPA
    USA300_FPR3757  MANLQKYIEYSREVQQARENNQPIVALESTIISHGMPYPQNVEMATTVEQIIRNNGAIPA
                    ************************************************************

    COL             TIAIIDGKIKIGLESEDLEILATSKDVAKVSRRDLAEVIAMKCVGATTVATTMICAAMAG
    N315            TIAIIDGKIKIGLESEDLEILATSKDVAKVSRRDLAEVVAMKCVGATTVATTMICAAMAG
    NCTC8325        TIAIIDGKIKIGLESEDLEILATSKDVAKVSRRDLAEVIAMKCVGATTVATTMICAAMAG
    Newman          TIAIIDGKIKIGLESEDLEILATSKDVAKVSRRDLAEVIAMKCVGATTVATTMICAAMAG
    USA300_FPR3757  TIAIIDGKIKIGLESEDLEILATSKDVAKVSRRDLAEVIAMKCVGATTVATTMICAAMAG
                    **************************************:*********************

    COL             IQFFVTGGIGGVHKGAEHTMDISADLEELSKTNVTVICAGAKSILDLPKTMEYLETKGVP
    N315            IQFFVTGGIGGVHKGAEHTMDISADLEELSKTNVTVICAGAKSILDLPKTMEYLETKGVP
    NCTC8325        IQFFVTGGIGGVHKGAEHTMDISADLEELSKTNVTVICAGAKSILDLPKTMEYLETKGVP
    Newman          IQFFVTGGIGGVHKGAEHTMDISADLEELSKTNVTVICAGAKSILDLPKTMEYLETKGVP
    USA300_FPR3757  IQFFVTGGIGGVHKGAEHTMDISADLEELSKTNVTVICAGAKSILDLPKTMEYLETKGVP
                    ************************************************************

    COL             VIGYQTNELPAFFTRESGVKLTSSVETPERLADIHLTKQQLNLEGGIVVANPIPYEHALS
    N315            VIGYQTNELPAFFTRESGVKLTSSVETPERLADIHLTKQQLNLEGGIVVANPIPYEHALS
    NCTC8325        VIGYQTNELPAFFTRESGVKLTSSVETPERLADIHLTKQQLNLEGGIVVANPIPYEHALS
    Newman          VIGYQTNELPAFFTRESGVKLTSSVETPERLADIHLTKQQLNLEGGIVVANPIPYEHALS
    USA300_FPR3757  VIGYQTNELPAFFTRESGVKLTSSVETPERLADIHLTKQQLNLEGGIVVANPIPYEHALS
                    ************************************************************

    COL             KAYIEAIINEAVVEAENQGIKGKDATPFLLGKIVEKTNGKSLAANIKLVENNAALGAKIA
    N315            KAYIEAIINEAVVEAENQGIKGKDATPFLLGKIVEKTNGKSLAANIKLVENNAALGAKIA
    NCTC8325        KAYIEAIINEAVVEAENQGIKGKDATPFLLGKIVEKTNGKSLAANIKLVENNAALGAKIA
    Newman          KAYIEAIINEAVVEAENQGIKGKDATPFLLGKIVEKTNGKSLAANIKLVENNAALGAKIA
    USA300_FPR3757  KAYIEAIINEAVVEAENQGIKGKDATPFLLGKIVEKTNGKSLAANIKLVENNAALGAKIA
                    ************************************************************

    COL             VAVNKLL
    N315            VAVNKLL
    NCTC8325        VAVNKLL
    Newman          VAVNKLL
    USA300_FPR3757  VAVNKLL
                    *******