From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001240000
  • symbol?: nanK
  • description?: ROK family protein

      descriptions from strain specific annotations:

    • ROK family protein
    • glucokinase
    • N-acetylmannosamine kinase
    • putative ROK family protein
    • transcriptional regulator
  • strand?: +
  • coordinates?: 1525116..1526018
  • synteny block?: BlockID0007510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0315
    08BA02176:
    C248_0305
    11819-97:
    MS7_0306
    71193:
    ST398NM01_0329
    ECT-R 2:
    ECTR2_276
    ED133:
    SAOV_0269
    ED98:
    SAAV_0283
    HO 5096 0412:
    SAEMRSA15_02720
    JH1:
    SaurJH1_0306
    JH9:
    SaurJH9_0299
    JKD6008:
    SAA6008_00292
    JKD6159:
    SAA6159_00292
    LGA251:
    SARLGA251_02780
    M013:
    M013TW_0297
    MRSA252:
    SAR0313
    MSHR1132:
    SAMSHR1132_02900
    MSSA476:
    SAS0293
    Mu3:
    SAHV_0313
    Mu50:
    SAV0316
    MW2:
    MW0293
    RF122:
    SAB0253
    ST398:
    SAPIG0329
    T0131:
    SAT0131_00320 (tnpC-3)
    TCH60:
    HMPREF0772_10179
    TW20:
    SATW20_03210
    USA300_TCH1516:
    USA300HOU_0336
    VC40:
    SAVC_01330

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYYIAIDIGGTQIKSAVIDKQLNMFDYQQISTPDNKSELITDKVYEIVTGYMKQYQLIQP
    N315            MYYIAIDIGGTQIKSAVIDKQLNMFDYQQISTPDNKSELITDKVYEIVTGYMKQYQLIQP
    NCTC8325        MYYIAIDIGGTQIKSAVIDKQLNMFDYQQISTPDNKSELITDKVYEIVTGYMKQYQLIQP
    Newman          MYYIAIDIGGTQIKSAVIDKQLNMFDYQQISTPDNKSELITDKVYEIVTGYMKQYQLIQP
    USA300_FPR3757  MYYIAIDIGGTQIKSAVIDKQLNMFDYQQISTPDNKSELITDKVYEIVTGYMKQYQLIQP
                    ************************************************************

    COL             VIGISSAGVVDEQKGEIVYAGPTIPNYKGTNFKRLLKSLSPYVKVKNDVNAALLGELKLH
    N315            VIGISSAGVVDEQKGEIGYAGPTIPNYKGTNFKRLLKSLSPYVKVKNDVNAALLGELKLH
    NCTC8325        VIGISSAGVVDEQKGEIVYAGPTIPNYKGTNFKRLLKSLSPYVKVKNDVNAALLGELKLH
    Newman          VIGISSAGVVDEQKGEIVYAGPTIPNYKGTNFKRLLKSLSPYVKVKNDVNAALLGELKLH
    USA300_FPR3757  VIGISSAGVVDEQKGEIVYAGPTIPNYKGTNFKRLLKSLSPYVKVKNDVNAALLGELKLH
                    ***************** ******************************************

    COL             QYQAERIFCMTLGTGIGGAYKNNQGHIDNGELHKANEVGYLLYRPTENTTFEQRAATSAL
    N315            QYQAERIFCMTLGTGIGGAYKNNQGHIDNGELHKANEVGYLLYRPTENTTFEQRAATSAL
    NCTC8325        QYQAERIFCMTLGTGIGGAYKNNQGHIDNGELHKANEVGYLLYRPTENTTFEQRAATSAL
    Newman          QYQAERIFCMTLGTGIGGAYKNNQGHIDNGELHKANEVGYLLYRPTENTTFEQRAATSAL
    USA300_FPR3757  QYQAERIFCMTLGTGIGGAYKNNQGHIDNGELHKANEVGYLLYRPTENTTFEQRAATSAL
                    ************************************************************

    COL             KKRMIAGGFTRSTHVPVLFEAAEEGDDIAKQILNEWAEDVAEGIAQIQVMYDPGLILIGG
    N315            KKRMIDGGFTRSTHVPVLFEAAEEGDDIAKQILNEWAEDVAEGIAQIQVMYDPGLILIGG
    NCTC8325        KKRMIAGGFTRSTHVPVLFEAAEEGDDIAKQILNEWAEDVAEGIAQIQVMYDPGLILIGG
    Newman          KKRMIAGGFTRSTHVPVLFEAAEEGDDIAKQILNEWAEDVAEGIAQIQVMYDPGLILIGG
    USA300_FPR3757  KKRMIAGGFTRSTHVPVLFEAAEEGDDIAKQILNEWAEDVAEGIAQIQVMYDPGLILIGG
                    ***** ******************************************************

    COL             GISEQGDNLIKYIEPKVAHYLPKDYVYAPIQTTKSKNDAALYGCLQ
    N315            GISEQGDNLIKYIEPKVAHYLPKDYVYAPIQTTKSKNDAALYGCLQ
    NCTC8325        GISEQGDNLIKYIEPKVAHYLPKDYVYAPIQTTKSKNDAALYGCLQ
    Newman          GISEQGDNLIKYIEPKVAHYLPKDYVYAPIQTTKSKNDAALYGCLQ
    USA300_FPR3757  GISEQGDNLIKYIEPKVAHYLPKDYVYAPIQTTKSKNDAALYGCLQ
                    **********************************************