Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN001319000
  • symbol?:
  • description?: phiSLT ORF204-like protein

      descriptions from strain specific annotations:

    • phiSLT ORF204-like protein
    • phi PVL ORF 30-like protein
  • strand?: -
  • coordinates?: 1600696..1601310
  • synteny block?: BlockID0008170
  • occurrence?: in 22% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    SaurJH1_1040
    JH9:
    SaurJH9_1021
    JKD6008:
    JKD6159:
    SAA6159_01416
    LGA251:
    M013:
    M013TW_1501
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_1489
    VC40:

Genome Viewer[edit source | edit]

NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    NCTC8325        MTQFLGALLLTGVLGYIPYKYLTMIGLVSEKNKIINTPVLLIFSIETCLIWFYTFIIFNN
    USA300_FPR3757  MTQFLGALLLTGVLGYIPYKYLTMIGLVSEKNKVINTPVLLIFSIETCLIWFYSFIIFNN
                    *********************************:*******************:******

    NCTC8325        VDLKNLSLLQLLTGLKANIWFLIIFVLTVLVFNPLIVKFIIWLINETRKFMNLDCISLLD
    USA300_FPR3757  VDLKNLNLIQLLTGLKANILFLFIFVLTVFVFNPLIVKFIIWLINITRKFMKLDCISLLD
                    ******.*:********** **:******:*************** *****:********

    NCTC8325        KRDKLFNNNGKPVFIVIKDFENRIIEEGELKTYNSAGSDFDLLEVERQDFKVSDLPSNDE
    USA300_FPR3757  KRDKLFNNNGKPVFIVIKDFENRIIEEGELKTYNSAGSDFDLLEVERQDFKVSDLPSNDE
                    ************************************************************

    NCTC8325        LYIKHTLVDLKQQIKLDLYLMNEY
    USA300_FPR3757  LYIKHTLVDLKQQIKLDLYLMNEY
                    ************************