From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN001695000
  • symbol?:
  • description?: phage tape measure protein
  • strand?: -
  • coordinates?: 2032406..2035870
  • synteny block?: BlockID0011170
  • occurrence?: in 6% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    VC40:

Genome Viewer[edit source | edit]

NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    NCTC8325        MTEYKIKATIEASVAKFKRQIDSAVKSVQRFKRVADQTKDVELNANDKNLQKTIKVAKKS
    Newman          MTEYKIKATIEASVAKFKRQIDSAVKSVQRFKRVADQTKDVELNADDKKLQKTIKVAKKS
                    *********************************************:**:***********

    NCTC8325        LDAFSNKNVKAKLDASIQDLQQKVLESNFELDKLNSKEVTPEVKLQKQKLIKDIAETEAK
    Newman          LDAFSNKKVKAKLDASIQDLQQKVLESNFELDKLNSKEVTPEIKLQKQKLTKDIAEAEAK
                    *******:**********************************:******* *****:***

    NCTC8325        LSELEKKRVNIDVNADNSKFNRVLKVSKASLEALNRSKAKAIIDVDNGVANSKIKRTKEE
    Newman          LSELEKKRVNIDINADNSKFNRVLKVSKASLEALNRSKAKAIIDVDNGVANSKIKRTKEE
                    ************:***********************************************

    NCTC8325        LKSIPNKTRSRLDVDTGLSIPTIYAFKKSLDALPNKKTTKVDVDTNGLKKAYAYIIKAND
    Newman          LKSIPNKTRSRLDVDTGLSIPTIYAFKKSLDALPNKKTTKVDVDTNGLKKAYAYIIKVND
                    *********************************************************.**

    NCTC8325        NFQRQMGNLANMFRVFGTVGSNMVGGLLTSSFSILIPVIASVVPVVFALLNAIKVLTGGV
    Newman          NFQRQMGNLANMFRVFGTVGSNMVGGLLTSSFSILIPVIASVVPVVFALLNAIKVLTGGV
                    ************************************************************

    NCTC8325        LALGGAVAIAGAGFVAFGAMAISAIKMLNDGTLQASSATNEYKKALDGVKSAWTDIIKQN
    Newman          LALGGAVAIAGAGFVAFGAMAISAIKMLSDGTLQASSATNEYKKALDGVKSAWTDIIKQN
                    ****************************.*******************************

    NCTC8325        QSAIFTTLANGLNTVKTAMQSLQPFFSGISRGMEEASQSVLKWAENSSVASRFFNMMNTT
    Newman          QSAIFTTLANGLNTVKTAMQSLQPFFSGISRGMEEASQSVLKWAQNSGVASRFFNMMNTT
                    ********************************************:**.************

    NCTC8325        GVSVFNKLLSAAGGFGDGLVNVFTQLAPLFQWSADWLDRLGQSFSNWANSAAGENSITRF
    Newman          GVSVFNKLLSAAGGFGDGLVNVFTQLAPLFQWSADWLDRLGQSFSNWANSAAGENSITRF
                    ************************************************************

    NCTC8325        IEYTKTNLPIIGNIFKNVFVGINNLMNAFSGSSTGIFQSLEQMTAKFREWSEQVGQSQGF
    Newman          IEYTKTNLPIIGNIFKNVFVGINNLMNAFSGSSTGIFQSLEQMTAKFREWSEQVGQSQGF
                    ************************************************************

    NCTC8325        KDFVSYIQTNGPLIMQLIGNIARGLVAFATAMAPIASAVLRVAVAITGWIANLFEAHPAT
    Newman          KDFVSYIQTNGPLIMQLIGNIARGLVAFATAMAPIASAVLRVAVAITGWIANLFEAHPAT
                    ************************************************************

    NCTC8325        AQLVGVIITLVGAFRFLIPIILAVSNFMGGGLIGRIIALVSKFGLLRAGLTILKGAFMLL
    Newman          AQLVGVIITLVGAFRFLIAPILAVMDFL-GPLAARLVALVTKFGWAKTGTLVLSKAMTSL
                    ******************. **** :*: * * .*::***:***  ::*  :*. *:  *

    NCTC8325        KGPLKIISVIFQLLFGKIGLIRNAITGLVTVFGILGGPITIVIGVIAALIAIFVLLWNKN
    Newman          KGPIKLVTAIFQLLFGKIGLIRNAITGLVTVFGILGGPITIVIGVIAALIAIFVLLWNKN
                    ***:*:::.***************************************************

    NCTC8325        EGFRNFIINAWNAIKTFMVNVWNVLKAVASVVWNAILTAITTAVSNVYNFIMIVWNQIVA
    Newman          EGFRNFIINVWNAIKTFMVTVWNVLKTVASVVWNAILKAITTAVSNVYNFIMIIWNQIVA
                    *********.*********.******:**********.***************:******

    NCTC8325        YLQGLWNGIIAIATTVWNLLVTIITTVFTTIMTIVMTIWTAIWTFLSTIWNTIITIATTI
    Newman          YLQGLWNGIIAIATTVWNLLVTIITTVFTTIMTIVMTIWTAIWTFLSTIWNTIITIATTI
                    ************************************************************

    NCTC8325        WNLLVTVITTVFTTIMTIAITIWNAIWTFLQTLWNTIVTVATKVWNAITTAISTALQAAW
    Newman          WNLLVTVITTVFTTIMTIAMTIWNAIWTFLQTLWNTIVTVATKVWNAITTTISTALQAAW
                    *******************:******************************:*********

    NCTC8325        SFISNIWNTIWSFLSGILTTIWNKVVSIFTQVVSTISDKMSQAWNFIVTKGMQWVSTITS
    Newman          SFISNIWNTIWSFLSGILTTIWNKVVSIFTQVVSTISDKMSQAWNFIVTKGMQWVSTITS
                    ************************************************************

    NCTC8325        TLINFVNRVVQGFVNVVNKVSQGMTNAVNKVKSFVDDFVSAGADMIRGLMRGIGNMARDL
    Newman          TLINFVNRVIQGFVNVVNKVSQGMTNAVNKIKSFIGDFVSAGADMIRGLIRGIGQMAGQL
                    *********:********************:***:.*************:****:** :*

    NCTC8325        AEKAASVAKGALNAAKRALGIHSPSREFMDVGMYSMLGFVKGIDNHSSKVIRNVSNVADK
    Newman          VDAAKNVAKKALDAAKSALGIHSPSREFMDVGMYSMLGFVKGIDNHSSKVIRNVSNVADK
                    .: * .*** **:*** *******************************************

    NCTC8325        VVDAFQPTLNAPDISSITGNLSNLGGNINAQVQHTHSIETSPNMKTVKVEFDVNNDALTS
    Newman          VVDAFQPTLNAPDISSITGNLSNLGGNINAQVQHTHSIETSPNMKTVKVEFDVNNDALTS
                    ************************************************************

    NCTC8325        IVNGRNAKRNSEYYL
    Newman          IVNGRNAKRNSEYYL
                    ***************