From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN001710000
  • symbol?:
  • description?: phage family protein

      descriptions from strain specific annotations:

    • phage family protein
    • phage protein
    • phiSLT ORF 99-like protein
    • hypothetical phage-related protein
    • phage-like protein
  • strand?: -
  • coordinates?: 2055846..2056145
  • synteny block?: BlockID0011310
  • occurrence?: in 56% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_0369
    11819-97:
    MS7_1448
    71193:
    ECT-R 2:
    ED133:
    SAOV_0339
    ED98:
    SAAV_2012
    HO 5096 0412:
    SAEMRSA15_13540
    JH1:
    SaurJH1_1099
    JH9:
    SaurJH9_1078
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR1499
    MSHR1132:
    MSSA476:
    SAS0952
    Mu3:
    Mu50:
    MW2:
    MW1382
    RF122:
    SAB0264
    ST398:
    SAPIG0394
    T0131:
    TCH60:
    HMPREF0772_11710
    TW20:
    USA300_TCH1516:
    USA300HOU_1434
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFGFTKRHEQDWRLTRLEENDKTMFEKFDRIEDSLRTQEKIYDKLDRNFEELRRDKEEDE
    NCTC8325        MFGFTKRHEQDWRLTRLEENDKTMFEKFDRIEDSLRTQEKIYDKLDRNFEELRRDKEEDE
    Newman          MFGFTKRHEQDWRLTRLEENDKTMFEKFDRIEDSLRTQEKIYDKLDRNFEELRRDKVEDE
    USA300_FPR3757  MFGFTKRHEQDWRLTRLEENDKTMFEKFDRIEDSLRTQEKIYDKLDRNFEELRRDKEEDE
                    ******************************************************** ***

    COL             KNKEKNAKNIRDIKMWILGLIGTILSTFVIALLKTIFGI
    NCTC8325        KNKEKNAKNIRDIKMWILGLIGTILSTFVIALLKTIFGI
    Newman          KNKEKNAKNIRDIKMWILGLIGTIFSTIVIALLRTIFGI
    USA300_FPR3757  KNKEKNAKNIRDIKMWILGLIGTILSTFVIALLKTIFGI
                    ************************:**:*****:*****