From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001856000
  • symbol?: gcvH-L
  • description?: glycine cleavage system protein H

      descriptions from strain specific annotations:

    • glycine cleavage system protein H
    • glycine cleavage system H protein
    • glycine cleavage H-protein
    • biotinyl-lipoyl attachment domain protein ,GcvH-like protein
    • GcvH family protein
    • glycine cleavage H-family protein
    • glycine cleavage system H protein, putative
    • putative glycine cleavage H-protein
  • strand?: +
  • coordinates?: 2354769..2355101
  • synteny block?: BlockID0012310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0323
    08BA02176:
    C248_0377
    11819-97:
    MS7_0314
    71193:
    ST398NM01_0404
    ECT-R 2:
    ECTR2_284
    ED133:
    SAOV_0350
    ED98:
    SAAV_0292
    HO 5096 0412:
    SAEMRSA15_02800
    JH1:
    SaurJH1_0383
    JH9:
    SaurJH9_0373
    JKD6008:
    SAA6008_00301
    JKD6159:
    SAA6159_00300
    LGA251:
    SARLGA251_02860
    M013:
    M013TW_0305
    MRSA252:
    SAR0321
    MSHR1132:
    SAMSHR1132_02980
    MSSA476:
    SAS0301
    Mu3:
    SAHV_0321
    Mu50:
    SAV0324
    MW2:
    MW0301
    RF122:
    SAB0274
    ST398:
    SAPIG0404
    T0131:
    SAT0131_00329
    TCH60:
    HMPREF0772_10171
    TW20:
    SATW20_03920
    USA300_TCH1516:
    USA300HOU_0345
    VC40:
    SAVC_01370

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKLANYLWVEKVGDLYVFSMTPELQDDIGTVGYVEFVSPDEVKVDDEIVSIEASKTVID
    N315            MKKLANYLWVEKVGDLYVFSMTPELQDDIGTVGYVEFVSPDEVKVDDEIVSIEASKTVID
    NCTC8325        MKKLANYLWVEKVGDLYVFSMTPELQDDIGTVGYVEFVSPDEVKVDDEIVSIEASKTVID
    Newman          MKKLANYLWVEKVGDLYVFSMTPELQDDIGTVGYVEFVSPDEVKVDDEIVSIEASKTVID
    USA300_FPR3757  MKKLANYLWVEKVGDLYVFSMTPELQDDIGTVGYVEFVSPDEVKVDDEIVSIEASKTVID
                    ************************************************************

    COL             VQTPLSGTIIERNTKAEEEPTILNSEKPEENWLFKLDDVDKEAFLALPEA
    N315            VQTPLSGTIIERNTKAEEEPTILNSEKPEENWLFKLDDVDKEAFLALPEA
    NCTC8325        VQTPLSGTIIERNTKAEEEPTILNSEKPEENWLFKLDDVDKEAFLALPEA
    Newman          VQTPLSGTIIERNTKAEEEPTILNSEKPEENWLFKLDDVDKEAFLALPEA
    USA300_FPR3757  VQTPLSGTIIERNTKAEEEPTILNSEKPEENWLFKLDDVDKEAFLALPEA
                    **************************************************