From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001864000
  • symbol?:
  • description?: sugar-specific PTS component EIIB

      descriptions from strain specific annotations:

    • sugar-specific PTS component EIIB
    • phosphotransferase system, lactose/cellobiose-specific IIB subunit
    • PTS system lactose/cellobiose-specific transporter subunit IIB
    • PTS system, Lactose/Cellobiose specific IIB subunit
    • PTS transport system protein
    • PTS family porter component IIB
    • putative PTS transport system protein
    • PTS system component
    • PTS sysytem, mannitol-specific enzyme II, B component
    • PTS system transporter subunit IIB
    • PTS transporter
  • strand?: -
  • coordinates?: 2360635..2360874
  • synteny block?: BlockID0012380
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0329
    08BA02176:
    C248_0384
    11819-97:
    MS7_0320
    71193:
    ST398NM01_0411
    ECT-R 2:
    ECTR2_290
    ED133:
    SAOV_0355c
    ED98:
    SAAV_0298
    HO 5096 0412:
    SAEMRSA15_02860
    JH1:
    SaurJH1_0389
    JH9:
    SaurJH9_0379
    JKD6008:
    SAA6008_00307
    JKD6159:
    SAA6159_00305
    LGA251:
    SARLGA251_02910
    M013:
    M013TW_0310
    MRSA252:
    SAR0327
    MSHR1132:
    SAMSHR1132_03040
    MSSA476:
    SAS0307
    Mu3:
    SAHV_0327
    Mu50:
    SAV0330
    MW2:
    MW0307
    RF122:
    SAB0279c
    ST398:
    SAPIG0411
    T0131:
    SAT0131_00335
    TCH60:
    HMPREF0772_10165
    TW20:
    SATW20_03980
    USA300_TCH1516:
    USA300HOU_0351
    VC40:
    SAVC_01400

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKILVVCGHGLGSSFMVEMNAQEALRQLNAPSDIEVEHSDIMTASPEMADLFICGRDLAE
    N315            MKILVVCGHGLGSSFMVEMNAQEALRQLNAPSDIEVEHSDIMTASPEMADLFICGRDLAE
    NCTC8325        MKILVVCGHGLGSSFMVEMNAQEALRQLNAPSDIEVEHSDIMTASPEMADLFICGRDLAE
    Newman          MKILVVCGHGLGSSFMVEMNAQEALRQLNAPSDIEVEHSDIMTASPEMADLFICGRDLAE
    USA300_FPR3757  MKILVVCGHGLGSSFMVEMNAQEALRQLNAPSDIEVEHSDIMTASPEMADLFICGRDLAE
                    ************************************************************

    COL             NAERLGDVLVLDNILDKAELQQKLSEKLQQLNMI
    N315            NAERLGDVLVLDNILDKAELQQKLSEKLQQLNMI
    NCTC8325        NAERLGDVLVLDNILDKAELQQKLSEKLQQLNMI
    Newman          NAERLGDVLVLDNILDKAELQQKLSEKLQQLNMI
    USA300_FPR3757  NAERLGDVLVLDNILDKAELQQKLSEKLQQLNMI
                    **********************************