From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001866000
  • symbol?:
  • description?: BglG family transcriptional antiterminator

      descriptions from strain specific annotations:

    • BglG family transcriptional antiterminator
    • PRD domain-containing protein
    • probable PTS system regulator
    • PTS regulator
    • PTS system, Lactose/Cellobiose specific IIB subunit
    • putative PTS multidomain regulator
    • putative transcriptional antiterminator, BglG family
    • Putative transcriptional antiterminator, BglG family / PTS system, mannitol/fructose-specific IIA component
    • transcriptional antiterminator BglG
    • transcription antiterminator
  • strand?: -
  • coordinates?: 2361369..2363327
  • synteny block?: BlockID0012400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0331
    08BA02176:
    C248_0386
    11819-97:
    MS7_0322
    71193:
    ST398NM01_0413
    ECT-R 2:
    ECTR2_292
    ED133:
    SAOV_0357c
    ED98:
    SAAV_0300
    HO 5096 0412:
    SAEMRSA15_02880
    JH1:
    SaurJH1_0391
    JH9:
    SaurJH9_0381
    JKD6008:
    SAA6008_00309
    JKD6159:
    SAA6159_00307
    LGA251:
    SARLGA251_02930
    M013:
    M013TW_0312
    MRSA252:
    SAR0329
    MSHR1132:
    SAMSHR1132_03060
    MSSA476:
    SAS0309
    Mu3:
    SAHV_0329
    Mu50:
    SAV0332
    MW2:
    MW0309
    RF122:
    SAB0281c
    ST398:
    SAPIG0413
    T0131:
    SAT0131_00337
    TCH60:
    HMPREF0772_10163
    TW20:
    SATW20_04000
    USA300_TCH1516:
    USA300HOU_0353
    VC40:
    SAVC_01410

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLSYRQIEILYLLIHEQTFIPINTIANQLGVSPRTIQYDIAYIEQYAETYHYQVSRNKAA
    N315            MLSYRQIEILYLLIHEQTFIPINTIANQLGVSPRTIQYDIAYIEQYAETYHYQVSRNKAA
    NCTC8325        MLSYRQIEILYLLIHEQTFIPINTIANQLGVSPRTIQYDIAYIEQYAETYHYQVSRNKAA
    Newman          MLSYRQIEILYLLIHEQTFIPINTIANQLGVSPRTIQYDIAYIEQYAETYHYQVSRNKAA
    USA300_FPR3757  MLSYRQIEILYLLIHEQTFIPINTIANQLGVSPRTIQYDIAYIEQYAETYHYQVSRNKAA
                    ************************************************************

    COL             GIKVTTAHATLLNELEHNLTNQIHFSKDERLTHIALKLFETTDPVSTKQLAQDVNVSRRT
    N315            GIKVTTAHATLLNELEHNLTNQIHFSKDERLTHIALKLFETTDPVSTKQLAQDVNVSRRT
    NCTC8325        GIKVTTAHATLLNELEHNLTNQIHFSKDERLTHIALKLFETTDPVSTKQLAQDVNVSRRT
    Newman          GIKVTTAHATLLNELEHNLTNQIHFSKDERLTHIALKLFETTDPVSTKQLAQDVNVSRRT
    USA300_FPR3757  GIKVTTAHATLLNELEHNLTNQIHFSKDERLTHIALKLFETTDPVSTKQLAQDVNVSRRT
                    ************************************************************

    COL             IADDIKMIQAQLDQYHLKLNYVHNKGFNIIGEEDHYRKAYAHFIHQYMKQAAPFIEADIF
    N315            IADDIKMIQAQLDQYHLKLNYVHNKGFNVIGEEDHYRKAYAHFIHQYMKQAAPFIEADIF
    NCTC8325        IADDIKMIQAQLDQYHLKLNYVHNKGFNIIGEEDHYRKAYAHFIHQYMKQAAPFIEADIF
    Newman          IADDIKMIQAQLDQYHLKLNYVHNKGFNIIGEEDHYRKAYAHFIHQYMKQAAPFIEADIF
    USA300_FPR3757  IADDIKMIQAQLDQYHLKLNYVHNKGFNIIGEEDHYRKAYAHFIHQYMKQAAPFIEADIF
                    ****************************:*******************************

    COL             NSESIALVRRAIIKTLNSENYHLVQSAIDGLIYHILIAIQRLNENFSFDIPINEIDKWRH
    N315            NSESIALVRRAIIKTLNSENYHLVQSAIDGLIYHILIAIQRLNENFSFDIPINEIDKWRH
    NCTC8325        NSESIALVRRAIIKTLNSENYHLVQSAIDGLIYHILIAIQRLNENFSFDIPINEIDKWRH
    Newman          NSESIALVRRAIIKTLNSENYHLVQSAIDGLIYHILIAIQRLNENFSFDIPINEIDKWRH
    USA300_FPR3757  NSESIALVRRAIIKTLNSENYHLVQSAIDGLIYHILIAIQRLNENFSFDIPINEIDKWRH
                    ************************************************************

    COL             TNQYAIASKMIENLERSCNVTFPESEIIFITLHLLGSKMTEHTASSITFEYHDLSQNIHE
    N315            TNQYAIASKMIENLERSCNVTFPESEIIFITLHLLGSKMTEHTASSITFEYHDLSQNIHE
    NCTC8325        TNQYAIASKMIENLERSCNVTFPESEIIFITLHLLGSKMTEHTASSITFEYHDLSQNIHE
    Newman          TNQYAIASKMIENLERSCNVTFPESEIIFITLHLLGSKMTEHTASSITFEYHDLSQNIHE
    USA300_FPR3757  TNQYAIASKMIENLERSCNVTFPESEIIFITLHLLGSKMTEHTASSITFEYHDLSQNIHE
                    ************************************************************

    COL             LITCVSQELGIDMSKDNKLHTSLITHIKPAIHRIKYDMLQPNPLRQEVMRRYPQIIEAVS
    N315            LITCVSQELGIDMSKDNKLHTSLITHIKPAIHRIKYDMLQPNPLRQEVMRRYPQIIEAVS
    NCTC8325        LITCVSQELGIDMSKDNKLHTSLITHIKPAIHRIKYDMLQPNPLRQEVMRRYPQIIEAVS
    Newman          LITCVSQELGIDMSKDNKLHTSLITHIKPAIHRIKYDMLQPNPLRQEVMRRYPQIIEAVS
    USA300_FPR3757  LITCVSQELGIDMSKDNKLHTSLITHIKPAIHRIKYDMLQPNPLRQEVMRRYPQIIEAVS
                    ************************************************************

    COL             KHISPIEQDAAIRFNEDELTYITIHFASSIERVATHKQSMIKVVLLCGSGIGTSQLLKSK
    N315            KHISPIEQDAAIRFNEDELTYITIHFASSIERVATHKQSMIKVVLLCGSGIGTSQLLKSK
    NCTC8325        KHISPIEQDAAIRFNEDELTYITIHFASSIERVATHKQSMIKVVLLCGSGIGTSQLLKSK
    Newman          KHISPIEQDAAIRFNEDELTYITIHFASSIERVATHKQSMIKVVLLCGSGIGTSQLLKSK
    USA300_FPR3757  KHISPIEQDAAIRFNEDELTYITIHFASSIERVATHKQSMIKVVLLCGSGIGTSQLLKSK
                    ************************************************************

    COL             LNHLYPEFHIWDAYSIYQLEESRLLQDNIDYVISTVPCEISAVPVIHVDPFINQQSRQKL
    N315            LNHLYPEFHIWDAYSIYQLEESRLLQDNIDYVISTVPCEISAVPVIHVDPFINQQSRQKL
    NCTC8325        LNHLYPEFHIWDAYSIYQLEESRLLQDNIDYVISTVPCEISAVPVIHVDPFINQQSRQKL
    Newman          LNHLYPEFHIWDAYSIYQLEESRLLQDNIDYVISTVPCEISAVPVIHVDPFINQQSRQKL
    USA300_FPR3757  LNHLYPEFHIWDAYSIYQLEESRLLQDNIDYVISTVPCEISAVPVIHVDPFINQQSRQKL
                    ************************************************************

    COL             NQIINDSREQRVMKMATDGKSLADLLPEHRIIINKQPLSIESAIAVAVQPLINDGIVYSN
    N315            NQIINDSREQRVMKMATDGKSLADLLPEHRIIINEQPLSIESAIAVAVQPLINDGIVYSN
    NCTC8325        NQIINDSREQRVMKMATDGKSLADLLPEHRIIINKQPLSIESAIAVAVQPLINDGIVYSN
    Newman          NQIINDSREQRVMKMATDGKSLADLLPEHRIIINKQPLSIESAIAVAVQPLINDGIVYSN
    USA300_FPR3757  NQIINDSREQRVMKMATDGKSLADLLPEHRIIINKQPLSIESAIAVAVQPLINDGIVYSN
                    **********************************:*************************

    COL             YTAAILKQFEQFGSYMVISPHIALIHAGTDYVQNGVGFALTYFTEGIIFGSKANDPVHLV
    N315            YTAAILKQFEQFGSYMVISPHIALIHAGTDYVQNGVGFALTYFTEGIIFGSKANDPVHLV
    NCTC8325        YTAAILKQFEQFGSYMVISPHIALIHAGTDYVQNGVGFALTYFTEGIIFGSKANDPVHLV
    Newman          YTAAILKQFEQFGSYMVISPHIALIHAGTDYVQNGVGFALTYFTEGIIFGSKANDPVHLV
    USA300_FPR3757  YTAAILKQFEQFGSYMVISPHIALIHAGTDYVQNGVGFALTYFTEGIIFGSKANDPVHLV
                    ************************************************************

    COL             ITLATDHPNAHLKALGQLSECLSNDLYRQDFLDGNIFKIKQHIALTMTKEA
    N315            ITLATDHPNAHLKALGQLSECLSNDLYRQDFLDGNIFKIKQHIALTMTKEV
    NCTC8325        ITLATDHPNAHLKALGQLSECLSNDLYRQDFLDGNIFKIKQHIALTMTKEA
    Newman          ITLATDHPNAHLKALGQLSECLSNDLYRQDFLDGNIFKIKQHIALTMTKEA
    USA300_FPR3757  ITLATDHPNAHLKALGQLSECLSNDLYRQDFLDGNIFKIKQHIALTMTKEA
                    **************************************************.