From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001875000
  • symbol?:
  • description?: bacterial luciferase

      descriptions from strain specific annotations:

    • bacterial luciferase
    • luciferase-like monooxygenase
    • luciferase family protein
    • luciferase-like monooxygenase family protein
    • alkanal monooxygenase
    • putative luciferase-like monooxygenase
    • bacterial luciferase family protein
  • strand?: +
  • coordinates?: 2368671..2369780
  • synteny block?: BlockID0012490
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0337
    08BA02176:
    C248_0393
    11819-97:
    MS7_0328
    71193:
    ST398NM01_0419
    ECT-R 2:
    ECTR2_298
    ED133:
    SAOV_0363
    ED98:
    SAAV_0306
    HO 5096 0412:
    SAEMRSA15_02940
    JH1:
    SaurJH1_0397
    JH9:
    SaurJH9_0387
    JKD6008:
    SAA6008_00315
    JKD6159:
    SAA6159_00313
    LGA251:
    SARLGA251_02990
    M013:
    M013TW_0318
    MRSA252:
    SAR0335
    MSHR1132:
    SAMSHR1132_03120
    MSSA476:
    SAS0315
    Mu3:
    SAHV_0336
    Mu50:
    SAV0339
    MW2:
    MW0315
    RF122:
    SAB0288
    ST398:
    SAPIG0419
    T0131:
    SAT0131_00343 (hemC)
    TCH60:
    HMPREF0772_10157
    TW20:
    SATW20_04060
    USA300_TCH1516:
    USA300HOU_0359
    VC40:
    SAVC_01440

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKLEMNKNTPLEFGLYSLGDHLLNPLKGEKVSYEQRINEIIEASKLADEAGIDVFAVGE
    N315            MAKLEMNKNTPLEFGLYSLGDHLLNPFKGEKVSYEQRINEIIEASKLADETGIDVFAVGE
    NCTC8325        MAKLEMNKNTPLEFGLYSLGDHLLNPLKGEKVSYEQRINEIIEASKLADEAGIDVFAVGE
    Newman          MAKLEMNKNTPLEFGLYSLGDHLLNPLKGEKVSYEQRINEIIEASKLADEAGIDVFAVGE
    USA300_FPR3757  MAKLEMNKNTPLEFGLYSLGDHLLNPLKGEKVSYEQRINEIIEASKLADEAGIDVFAVGE
                    **************************:***********************:*********

    COL             SHQEHFTTQAHTVVLGAIAQATKHIKVSSSSTIISATDPVRVFEDFATLDLISHGRAEIV
    N315            SHQEHFTTQAHTVVLGAIAQATKHIKVSSSSTIISATDPVRVFEDFATLDLISHGRAEIV
    NCTC8325        SHQEHFTTQAHTVVLGAIAQATKHIKVSSSSTIISATDPVRVFEDFATLDLISHGRAEIV
    Newman          SHQEHFTTQAHTVVLGAIAQATKHIKVSSSSTIISATDPVRVFEDFATLDLISHGRAEIV
    USA300_FPR3757  SHQEHFTTQAHTVVLGAIAQATKHIKVSSSSTIISATDPVRVFEDFATLDLISHGRAEIV
                    ************************************************************

    COL             AGRASRTGIFDLFGYDLKDYDELFEEKLGLLLELNKTERITWSGKYRPELRNMKIFPRPI
    N315            AGRASRTGIFDLFGYDLKDYDELFEEKLGLLLELNKTERITWSGKYRPELRNMKIFPRPI
    NCTC8325        AGRASRTGIFDLFGYDLKDYDELFEEKLGLLLELNKTERITWSGKYRPELRNMKIFPRPI
    Newman          AGRASRTGIFDLFGYDLKDYDELFEEKLGLLLELNKTERITWSGKYRPELRNMKIFPRPI
    USA300_FPR3757  AGRASRTGIFDLFGYDLKDYDELFEEKLGLLLELNKTERITWSGKYRPELRNMKIFPRPI
                    ************************************************************

    COL             DNILPIWRAVGGPPASAIKAGKQGVPMMITTLGGPAMNFKGSIDAYRQAATEAGFDASPK
    N315            DNILPIWRAVGGPPASAIKAGKQGVPMMITTLGGPAMNFKGSIDAYRQAATEAGFDASHK
    NCTC8325        DNILPIWRAVGGPPASAIKAGKQGVPMMITTLGGPAMNFKGSIDAYRQAATEAGFDASPK
    Newman          DNILPIWRAVGGPPASAIKAGKQGVPMMITTLGGPAMNFKGSIDAYRQAATEAGFDASPK
    USA300_FPR3757  DNILPIWRAVGGPPASAIKAGKQGVPMMITTLGGPAMNFKGSIDAYRQAATEAGFDASPK
                    ********************************************************** *

    COL             SLPVSTASLFYTAETTQDAMREFYPHLNTGMSFIRGVGYPKQQFANSSDYREALMVGSPQ
    N315            SLPVSTASLFYTAETTQDAMREFYPHLNTGMSFIRGVGYPKQQFANSSDYREALMVGSPQ
    NCTC8325        SLPVSTASLFYTAETTQDAMREFYPHLNTGMSFIRGVGYPKQQFANSSDYREALMVGSPQ
    Newman          SLPVSTASLFYTAETTQDAMREFYPHLNTGMSFIRGVGYPKQQFANSSDYREALMVGSPQ
    USA300_FPR3757  SLPVSTASLFYTAETTQDAMREFYPHLNTGMSFIRGVGYPKQQFANSSDYREALMVGSPQ
                    ************************************************************

    COL             QIIEKILYQHELYGHQRFMAQLDFGGVPFENVMKNIELIGNDIIPAIKKHLSK
    N315            QIIEKILYQHELYGHQRFMAQLDFGGVPFENVMKNIELIGNEIIPAIKKHLSK
    NCTC8325        QIIEKILYQHELYGHQRFMAQLDFGGVPFENVMKNIELIGNDIIPAIKKHLSK
    Newman          QIIEKILYQHELYGHQRFMAQLDFGGVPFENVMKNIELIGNDIIPAIKKHLSK
    USA300_FPR3757  QIIEKILYQHELYGHQRFMAQLDFGGVPFENVMKNIELIGNDIIPAIKKHLSK
                    *****************************************:***********