From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001892000
  • symbol?:
  • description?: transcriptional regulator

      descriptions from strain specific annotations:

    • transcriptional regulator
    • Cro/CI family transcriptional regulator
    • Cro/CI family transcriptional regulator-like protein
    • DNA-binding protein, putative transcriptional regulator
    • helix-turn-helix family protein
    • putative DNA-binding protein
    • putative transcriptional regulator, Cro/CI family
    • Transcriptional regulator, Cro/CI family
    • XRE family transcriptional regulator
  • strand?: +
  • coordinates?: 2380367..2380570
  • synteny block?: BlockID0012650
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0347
    08BA02176:
    C248_0404
    11819-97:
    MS7_0339
    71193:
    ST398NM01_0429
    ECT-R 2:
    ECTR2_310
    ED133:
    SAOV_0373
    ED98:
    SAAV_0317
    HO 5096 0412:
    SAEMRSA15_03040
    JH1:
    SaurJH1_0407
    JH9:
    SaurJH9_0397
    JKD6008:
    SAA6008_00326
    JKD6159:
    SAA6159_00323
    LGA251:
    SARLGA251_03110
    M013:
    M013TW_0328
    MRSA252:
    SAR0346
    MSHR1132:
    SAMSHR1132_03220
    MSSA476:
    SAS0325
    Mu3:
    SAHV_0346
    Mu50:
    SAV0349
    MW2:
    MW0325
    RF122:
    SAB0299
    ST398:
    SAPIG0429
    T0131:
    SAT0131_00356
    TCH60:
    HMPREF0772_10145
    TW20:
    SATW20_04170
    USA300_TCH1516:
    USA300HOU_0370
    VC40:
    SAVC_01495

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRNRLKELRARDGLNQTQLAKQAGVSRQTISLIERNNFMPSVLTAIKIARIFNETVETVF
    N315            MRNRLKELRARDGLNQTQLAKLAGVSRQTISLIERNNFMPSVLTAIKIARIFNETVETVF
    NCTC8325        MRNRLKELRARDGLNQTQLAKQAGVSRQTISLIERNNFMPSVLTAIKIARIFNETVETVF
    USA300_FPR3757  MRNRLKELRARDGLNQTQLAKQAGVSRQTISLIERNNFMPSVLTAIKIARIFNETVETVF
                    ********************* **************************************

    COL             IIEEDEA
    N315            IIEEDEA
    NCTC8325        IIEEDEA
    USA300_FPR3757  IIEEDEA
                    *******