From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001899000
  • symbol?: mdh
  • description?: metal-dependent hydrolase

      descriptions from strain specific annotations:

    • metal-dependent hydrolase
    • cyclase family protein
    • Metal-dependent hydrolase/cyclase
    • Polyketide cyclase family protein
    • putative cyclase enzyme
    • putative cyclase protein
  • strand?: -
  • coordinates?: 2386387..2387139
  • synteny block?: BlockID0012720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0353
    08BA02176:
    C248_0411
    11819-97:
    MS7_0345
    71193:
    ST398NM01_0435
    ECT-R 2:
    ECTR2_316
    ED133:
    SAOV_0379c
    ED98:
    SAAV_0323
    HO 5096 0412:
    SAEMRSA15_03100
    JH1:
    SaurJH1_0413
    JH9:
    SaurJH9_0403
    JKD6008:
    SAA6008_00332
    JKD6159:
    SAA6159_00329
    LGA251:
    SARLGA251_03170
    M013:
    M013TW_0334
    MRSA252:
    SAR0352
    MSHR1132:
    SAMSHR1132_03280
    MSSA476:
    SAS0331
    Mu3:
    SAHV_0352
    Mu50:
    SAV0355
    MW2:
    MW0331
    RF122:
    SAB0305c
    ST398:
    SAPIG0435
    T0131:
    SAT0131_00362
    TCH60:
    HMPREF0772_10139
    TW20:
    SATW20_04230
    USA300_TCH1516:
    USA300HOU_0376
    VC40:
    SAVC_01525

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTQYPLWQQLNTLKQATWVDLTHTFDPEIPRFSEFEKGEVSTLFTVKDHGFYVQRWNIVT
    N315            MTQYPLWQQLNTLKQATWVDLTHTFDPEIPRFSEFEKGEVSTLFTVKDHGFYVQRWNIVT
    NCTC8325        MTQYPLWQQLNTLKQATWVDLTHTFDPEIPRFSEFEKGEVSTLFTVKDHGFYVQRWNIVT
    Newman          MTQYPLWQQLNTLKQATWVDLTHTFDPEIPRFSEFEKGEVSTLFTVKDHGFYVQRWNIVT
    USA300_FPR3757  MTQYPLWQQLNTLKQATWVDLTHTFDPEIPRFSEFEKGEVSTLFTVKDHGFYVQRWNIVT
                    ************************************************************

    COL             QYGTHIDAPIHFVENKRYLEDIDLKELVLPLIVLDFSTEVANNNDFIVTRAHIEAWEKEH
    N315            QYGTHIDAPIHFVENKRYLEDIDLKELVLPLIVLDFSTEVANNNDFIVTRAHIEAWEKEH
    NCTC8325        QYGTHIDAPIHFVENKRYLEDIDLKELVLPLIVLDFSTEVANNNDFIVTRAHIEAWEKEH
    Newman          QYGTHIDAPIHFVENKRYLEDIDLKELVLPLIVLDFSTEVANNNDFIVTRAHIEAWEKEH
    USA300_FPR3757  QYGTHIDAPIHFVENKRYLEDIDLKELVLPLIVLDFSTEVANNNDFIVTRAHIEAWEKEH
                    ************************************************************

    COL             GTIEPGTFVALRTDWSKRWPNIEKFENKDANGQQHAPGWGLDALKYLIEERRVEAVGHET
    N315            GTIEPGTFVALRTDWSKRWPNIEKFENKDANGQQHAPGWGLDALKYLIEERRVEAVGHET
    NCTC8325        GTIEPGTFVALRTDWSKRWPNIEKFENKDANGQQHAPGWGLDALKYLIEERRVEAVGHET
    Newman          GTIEPGTFVALRTDWSKRWPNIEKFENKDANGQQHAPGWGLDALKYLIEERRVEAVGHET
    USA300_FPR3757  GTIEPGTFVALRTDWSKRWPNIEKFENKDANGQQHAPGWGLDALKYLIEERRVEAVGHET
                    ************************************************************

    COL             FDTDASVDVVKNGDLVGERYILGQDKYQVELLTNLDQLPTRGAIIYAISPKPKDAPGFPV
    N315            FDTDASVDVVKNGDLVGERYILGQDKYQVELLTNLDQLPTRGAIIYAISPKPKDAPGFPV
    NCTC8325        FDTDASVDVVKNGDLVGERYILGQDKYQVELLTNLDQLPTRGAIIYAISPKPKDAPGFPV
    Newman          FDTDASVDVVKNGDLVGERYILGQDKYQVELLTNLDQLPTRGAIIYAISPKPKDAPGFPV
    USA300_FPR3757  FDTDASVDVVKNGDLVGERYILGQDKYQVELLTNLDQLPTRGAIIYAISPKPKDAPGFPV
                    ************************************************************

    COL             RAFAIKPSND
    N315            RAFAIKPSND
    NCTC8325        RAFAIKPSND
    Newman          RAFAIKPSND
    USA300_FPR3757  RAFAIKPSND
                    **********