From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001903000
  • symbol?: metI
  • description?: cystathionine gamma-synthase

      descriptions from strain specific annotations:

    • cystathionine gamma-synthase
    • trans-sulfuration enzyme family protein
    • cystathionine gamma-synthase (CGS) (O-succinylhomoserine(thiol)-lyase)
    • Cys/Met metabolism PLP-dependent enzyme
    • bifunctional cystathionine gamma-lyase/gamma-synthase
    • Cystathionine gamma-synthase / cysteine synthase
  • strand?: -
  • coordinates?: 2392374..2393477
  • synteny block?: BlockID0012760
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0357
    08BA02176:
    C248_0415
    11819-97:
    MS7_0349 (metB)
    71193:
    ST398NM01_0439
    ECT-R 2:
    ECTR2_320
    ED133:
    SAOV_0383c
    ED98:
    SAAV_0327
    HO 5096 0412:
    SAEMRSA15_03140
    JH1:
    SaurJH1_0417
    JH9:
    SaurJH9_0407
    JKD6008:
    SAA6008_00336
    JKD6159:
    SAA6159_00333
    LGA251:
    SARLGA251_03210
    M013:
    M013TW_0338
    MRSA252:
    SAR0356
    MSHR1132:
    SAMSHR1132_03320
    MSSA476:
    SAS0335
    Mu3:
    SAHV_0356
    Mu50:
    SAV0359
    MW2:
    MW0335
    RF122:
    SAB0309c
    ST398:
    SAPIG0439
    T0131:
    SAT0131_00366
    TCH60:
    HMPREF0772_10135 (metB)
    TW20:
    SATW20_04270
    USA300_TCH1516:
    USA300HOU_0380
    VC40:
    SAVC_01545

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKDTQLAQITLTDDSTGAIANPIHLSTAYKHPKLGQSTGFDYTRTKNPTRSTFETCFAKL
    N315            MKDTQLAQITLTDDSTGAIANPIHLSTAYKHPKLGQSTGFDYTRTKNPTRSTFETCFAKL
    NCTC8325        MKDTQLAQITLTDDSTGAIANPIHLSTAYKHPKLGQSTGFDYTRTKNPTRSTFETCFAKL
    Newman          MKDTQLAQITLTDDSTGAIANPIHLSTAYKHPKLGQSTGFDYTRTKNPTRSTFETCFAKL
    USA300_FPR3757  MKDTQLAQITLTDDSTGAIANPIHLSTAYKHPKLGQSTGFDYTRTKNPTRSTFETCFAKL
                    ************************************************************

    COL             EHGIASFATSSGMSAIQLICNLFKPHDEILVSFDLYGGTFRLFEFYEQQYDIKFKYVDFT
    N315            EHGIASFATSSGMSAIQLICNLFKPHDEILVSFDLYGGTFRLFEFYEQQYDIKFKYVDFT
    NCTC8325        EHGIASFATSSGMSAIQLICNLFKPHDEILVSFDLYGGTFRLFEFYEQQYDIKFKYVDFT
    Newman          EHGIASFATSSGMSAIQLICNLFKPHDEILVSFDLYGGTFRLFEFYEQQYDIKFKYVDFT
    USA300_FPR3757  EHGIASFATSSGMSAIQLICNLFKPHDEILVSFDLYGGTFRLFEFYEQQYDIKFKYVDFT
                    ************************************************************

    COL             DYEQVEKEITDKTVALFIEPISNPQMIAIDVKPYYQLCKAKGLLSIIDNTFLTPYLSTPL
    N315            DYEQVEKEITDKTVALFIEPISNPQMIAIDVKPYYQLCKAKGLLSIIDNTFLTPYLSTPL
    NCTC8325        DYEQVEKEITDKTVALFIEPISNPQMIAIDVKPYYQLCKAKGLLSIIDNTFLTPYLSTPL
    Newman          DYEQVEKEITDKTVALFIEPISNPQMIAIDVKPYYQLCKAKGLLSIIDNTFLTPYLSTPL
    USA300_FPR3757  DYEQVEKEITDKTVALFIEPISNPQMIAIDVKPYYQLCKAKGLLSIIDNTFLTPYLSTPL
                    ************************************************************

    COL             AEGADIVLHSATKYIGGHNDVLAGVVTVKDESLAQQLFDFHNMTGATLSPIDSYLLLRGL
    N315            AEGADIVLHSATKYIGGHNDVLAGVVTVKDESLAQQLFDFHNMTGATLSPIDSYLLLRGL
    NCTC8325        AEGADIVLHSATKYIGGHNDVLAGVVTVKDESLAQQLFDFHNMTGATLSPIDSYLLLRGL
    Newman          AEGADIVLHSATKYIGGHNDVLAGVVTVKDESLAQQLFDFHNMTGATLSPIDSYLLLRGL
    USA300_FPR3757  AEGADIVLHSATKYIGGHNDVLAGVVTVKDESLAQQLFDFHNMTGATLSPIDSYLLLRGL
                    ************************************************************

    COL             KTLHLRIERAQSNARKLAKKCQSLQAIDEVLYSGQTGMLSLRLNKAYSVAKLLENLDICI
    N315            KTLHLRIERAQSNARKLAKKCQSLQAIDEVLYSGQTGMLSLRLNKAYSVAKLLENLDICI
    NCTC8325        KTLHLRIERAQSNARKLAKKCQSLQAIDEVLYSGQTGMLSLRLNKAYSVAKLLENLDICI
    Newman          KTLHLRIERAQSNARKLAKKCQSLQAIDEVLYSGQTGMLSLRLNKAYSVAKLLENLDICI
    USA300_FPR3757  KTLHLRIERAQSNARKLAKKCQSLQAIDEVLYSGQTGMLSLRLNKAYSVAKLLENLDICI
                    ************************************************************

    COL             FAESLGGTETLVTFPYTQTHVDMPDAEKDKRGIDEYLIRLSLGVENYEDIERDIIQALDK
    N315            FAESLGGTETLVTFPYTQTHVDMPDAEKDKRGIDEYLIRLSLGVENYEDIERDIIQALDK
    NCTC8325        FAESLGGTETLVTFPYTQTHVDMPDAEKDKRGIDEYLIRLSLGVENYEDIERDIIQALDK
    Newman          FAESLGGTETLVTFPYTQTHVDMPDAEKDKRGIDEYLIRLSLGVENYEDIERDIIQALDK
    USA300_FPR3757  FAESLGGTETLVTFPYTQTHVDMPDAEKDKRGIDEYLIRLSLGVENYEDIERDIIQALDK
                    ************************************************************

    COL             AQIGEIV
    N315            AQIGEIV
    NCTC8325        AQIGEIV
    Newman          AQIGEIV
    USA300_FPR3757  AQIGEIV
                    *******