From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001914000
  • symbol?: rpsF
  • description?: 30S ribosomal protein S6

      descriptions from strain specific annotations:

    • 30S ribosomal protein S6
    • 30S ribosomal protein S6p
  • strand?: +
  • coordinates?: 2400102..2400398
  • synteny block?: BlockID0012860
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0437 (rpsF)
    N315:
    SA0352 (rpsF)
    NCTC8325:
    Newman:
    NWMN_0357 (rpsF)
    USA300_FPR3757:
    04-02981:
    SA2981_0363 (rpsF)
    08BA02176:
    C248_0422 (rpsF)
    11819-97:
    MS7_0355 (rpsF)
    71193:
    ST398NM01_0445
    ECT-R 2:
    ECTR2_326 (rpsF)
    ED133:
    SAOV_0389 (rpsF)
    ED98:
    SAAV_0333 (rpsF)
    HO 5096 0412:
    SAEMRSA15_03200 (rpsF)
    JH1:
    SaurJH1_0424 (rpsF)
    JH9:
    SaurJH9_0413 (rpsF)
    JKD6008:
    SAA6008_00342 (rpsF)
    JKD6159:
    SAA6159_00339 (rpsF)
    LGA251:
    SARLGA251_03270 (rpsF)
    M013:
    M013TW_0345
    MRSA252:
    SAR0362 (rpsF)
    MSHR1132:
    SAMSHR1132_03380
    MSSA476:
    SAS0341 (rpsF)
    Mu3:
    SAHV_0362 (rpsF)
    Mu50:
    SAV0365 (rpsF)
    MW2:
    MW0341 (rpsF)
    RF122:
    SAB0316 (rpsF)
    ST398:
    SAPIG0445 (rpsF)
    T0131:
    SAT0131_00373 (nrdR)
    TCH60:
    HMPREF0772_10129 (rpsF)
    TW20:
    SATW20_04330 (rpsF)
    USA300_TCH1516:
    USA300HOU_0387 (rpsF)
    VC40:
    SAVC_01575 (rpsF)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRTYEVMYIVRPNIEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFY
    N315            MRTYEVMYIVRPNIEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFY
    NCTC8325        MRTYEVMYIVRPNIEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFY
    Newman          MRTYEVMYIVRPNIEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFY
    USA300_FPR3757  MRTYEVMYIVRPNIEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFY
                    ************************************************************

    COL             NIVRVKSDNNKATDEFQRLAKISDDIIRYMVIREDEDK
    N315            NIVRVKSDNNKATDEFQRLAKISDDIIRYMVIREDEDK
    NCTC8325        NIVRVKSDNNKATDEFQRLAKISDDIIRYMVIREDEDK
    Newman          NIVRVKSDNNKATDEFQRLAKISDDIIRYMVIREDEDK
    USA300_FPR3757  NIVRVKSDNNKATDEFQRLAKISDDIIRYMVIREDEDK
                    **************************************