From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001970000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 2441514..2441883
  • synteny block?: BlockID0013230
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0370
    08BA02176:
    C248_0427
    11819-97:
    MS7_0362
    71193:
    ST398NM01_0449
    ECT-R 2:
    ECTR2_332
    ED133:
    SAOV_0395
    ED98:
    SAAV_0339
    HO 5096 0412:
    SAEMRSA15_03250
    JH1:
    SaurJH1_0430
    JH9:
    SaurJH9_0420
    JKD6008:
    SAA6008_00372
    JKD6159:
    SAA6159_00345
    LGA251:
    SARLGA251_03330
    M013:
    M013TW_0351
    MRSA252:
    SAR0389
    MSHR1132:
    SAMSHR1132_03440
    MSSA476:
    SAS0348
    Mu3:
    SAHV_0368
    Mu50:
    SAV0371
    MW2:
    MW0346
    RF122:
    SAB0322
    ST398:
    SAPIG0449
    T0131:
    SAT0131_00404
    TCH60:
    HMPREF0772_10123
    TW20:
    SATW20_04390
    USA300_TCH1516:
    USA300HOU_0394
    VC40:
    SAVC_01610

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKTILKTITYLVLTIIGAYAALFILKTIDSHGITDQFNPLVKKDDSYVKTTEVSTRMDDQ
    N315            MKTILKTITYLALTIIGAYAALFILKTIDSHGITDQFNPLVKEDDSYVKTTEVSTRMDDQ
    NCTC8325        MKTILKTITYLVLTIIGAYAALFILKTIDSHGITDQFNPLVKKDDSYVKTTEVSTRMDDQ
    Newman          MKTILKTITYLVLTIIGAYAALFILKTIDSHGITDQFNPLVKKDDSYVKTTEVSTRMDDQ
    USA300_FPR3757  MKTILKTITYLVLTIIGAYAALFILKTIDSHGITDQFNPLVKKDDSYVKTTEVSTRMDDQ
                    ***********.******************************:*****************

    COL             LRSYSQSVFNKEGKETQLMYTATFDVKPHRYLKITHKGHHVETFEEVEKEEVPKKALDKL
    N315            LRSYTQSAFNKEGKETQLMYTATFDVKPHRYLKITHKGHHVETFEEVEKEEVPKKALDKL
    NCTC8325        LRSYSQSVFNKEGKETQLMYTATFDVKPHRYLKITHKGHHVETFEEVEKEEVPKKALDKL
    Newman          LRSYSQSVFNKEGKETQLMYTATFDVKPHRYLKITHKGHHVETFEEVEKEEVPKKALDKL
    USA300_FPR3757  LRSYSQSVFNKEGKETQLMYTATFDVKPHRYLKITHKGHHVETFEEVEKEEVPKKALDKL
                    ****:**.****************************************************

    COL             SR
    N315            SR
    NCTC8325        SR
    Newman          SR
    USA300_FPR3757  SR
                    **