From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001971000
  • symbol?:
  • description?: peptidase propeptide and YPEB domain-containing protein

      descriptions from strain specific annotations:

    • peptidase propeptide and YPEB domain-containing protein
    • putative lipoprotein
    • putative secreted protease inhibitor
    • Lipoprotein
    • peptidase propeptide and ypeb domain protein
  • strand?: +
  • coordinates?: 2442030..2442636
  • synteny block?: BlockID0013240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0371
    08BA02176:
    C248_0428
    11819-97:
    MS7_0363
    71193:
    ST398NM01_0450
    ECT-R 2:
    ECTR2_333
    ED133:
    SAOV_0396
    ED98:
    SAAV_0340
    HO 5096 0412:
    SAEMRSA15_03260
    JH1:
    SaurJH1_0431
    JH9:
    SaurJH9_0421
    JKD6008:
    SAA6008_00373
    JKD6159:
    SAA6159_00346
    LGA251:
    SARLGA251_03340
    M013:
    M013TW_0352
    MRSA252:
    SAR0390
    MSHR1132:
    SAMSHR1132_03450
    MSSA476:
    SAS0349
    Mu3:
    SAHV_0369
    Mu50:
    SAV0372
    MW2:
    MW0347
    RF122:
    SAB0323
    ST398:
    SAPIG0450
    T0131:
    SAT0131_00405
    TCH60:
    HMPREF0772_10122
    TW20:
    SATW20_04400
    USA300_TCH1516:
    USA300HOU_0395
    VC40:
    SAVC_01615

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLKSLAVLSMSAVVLTACGNDTPKDETKSTESNTNQDTNTTKDVIALKDVKTSPEDAVK
    N315            MKLKSLAVLSMSAVVLTACGNDTPKDETKSTESNTNQDTNTTKDVIALKDVKTSPEDAVK
    NCTC8325        MKLKSLAVLSMSAVVLTACGNDTPKDETKSTESNTNQDTNTTKDVIALKDVKTSPEDAVK
    Newman          MKLKSLAVLSMSAVVLTACGNDTPKDETKSTESNTNQDTNTTKDVIALKDVKTSPEDAVK
    USA300_FPR3757  MKLKSLAVLSMSAVVLTACGNDTPKDETKSTESNTNQDTNTTKDVIALKDVKTSPEDAVK
                    ************************************************************

    COL             KAEETYKGQKLKGISFENSNGEWAYKVTQQKSGEESEVLVADKNKKVINKKTEKEDTMNE
    N315            KAEETYKGQKLKGISFENSNGEWAYKVTQQKSGEESEVLVADKNKKVINKKTEKEDTVNE
    NCTC8325        KAEETYKGQKLKGISFENSNGEWAYKVTQQKSGEESEVLVADKNKKVINKKTEKEDTMNE
    Newman          KAEETYKGQKLKGISFENSNGEWAYKVTQQKSGEESEVLVADKNKKVINKKTEKEDTMNE
    USA300_FPR3757  KAEETYKGQKLKGISFENSNGEWAYKVTQQKSGEESEVLVADKNKKVINKKTEKEDTMNE
                    *********************************************************:**

    COL             NDNFKYSDAIDYKKAIKEGQKEFDGDIKEWSLEKDDGKLVYNIDLKKGNKKQEVTVDAKN
    N315            NDNFKYSDAIDYKKAIKEGQKEFDGDIKEWSLEKDDGKLVYNIDLKKGNKKQEVTVDAKN
    NCTC8325        NDNFKYSDAIDYKKAIKEGQKEFDGDIKEWSLEKDDGKLVYNIDLKKGNKKQEVTVDAKN
    Newman          NDNFKYSDAIDYKKAIKEGQKEFDGDIKEWSLEKDDGKLVYNIDLKKGNKKQEVTVDAKN
    USA300_FPR3757  NDNFKYSDAIDYKKAIKEGQKEFDGDIKEWSLEKDDGKLVYNIDLKKGNKKQEVTVDAKN
                    ************************************************************

    COL             GKVLKSEQDH
    N315            GKVLKSEQDH
    NCTC8325        GKVLKSEQDH
    Newman          GKVLKSEQDH
    USA300_FPR3757  GKVLKSEQDH
                    **********