From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001973000
  • symbol?:
  • description?: GlsB/YeaQ/YmgE family stress response membrane protein

      descriptions from strain specific annotations:

    • GlsB/YeaQ/YmgE family stress response membrane protein
    • integral membrane protein
    • membrane spanning protein
    • transglycosylase associated family protein
  • strand?: +
  • coordinates?: 2443334..2443594
  • synteny block?: BlockID0013260
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0373
    08BA02176:
    C248_0430
    11819-97:
    MS7_0365
    71193:
    ST398NM01_0452
    ECT-R 2:
    ECTR2_335
    ED133:
    SAOV_0398
    ED98:
    SAAV_0342
    HO 5096 0412:
    SAEMRSA15_03280
    JH1:
    SaurJH1_0433
    JH9:
    SaurJH9_0423
    JKD6008:
    SAA6008_00375
    JKD6159:
    SAA6159_00348
    LGA251:
    SARLGA251_03360
    M013:
    M013TW_0354
    MRSA252:
    SAR0392
    MSHR1132:
    SAMSHR1132_03470
    MSSA476:
    SAS0351
    Mu3:
    SAHV_0371
    Mu50:
    SAV0374
    MW2:
    MW0349
    RF122:
    SAB0325
    ST398:
    SAPIG0452
    T0131:
    SAT0131_00407
    TCH60:
    HMPREF0772_10120
    TW20:
    SATW20_04420
    USA300_TCH1516:
    USA300HOU_0397
    VC40:
    SAVC_01625

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFGFIGMLIVGGLIGWAAGAIMGKDIPGGILGNIIAGIIGSWVGGKLFGQWGPELGSIYI
    N315            MFGFIGMLIVGGLIGWAAGAIMGKDIPGGILGNIIAGIIGSWVGGKLFGQWGPELGSIYI
    NCTC8325        MFGFIGMLIVGGLIGWAAGAIMGKDIPGGILGNIIAGIIGSWVGGKLFGQWGPELGSIYI
    Newman          MFGFIGMLIVGGLIGWAAGAIMGKDIPGGILGNIIAGIIGSWVGGKLFGQWGPELGSIYI
    USA300_FPR3757  MFGFIGMLIVGGLIGWAAGAIMGKDIPGGILGNIIAGIIGSWVGGKLFGQWGPELGSIYI
                    ************************************************************

    COL             LPALIGSIILIAIVTLILRAMRK
    N315            LPALIGSIILIAIVTLILRAMRK
    NCTC8325        LPALIGSIILIAIVTLILRAMRK
    Newman          LPALIGSIILIAIVTLILRAMRK
    USA300_FPR3757  LPALIGSIILIAIVTLILRAMRK
                    ***********************