From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001984000
  • symbol?: nfrA
  • description?: NADPH-dependent oxidoreductase

      descriptions from strain specific annotations:

    • NADPH-dependent oxidoreductase
    • NAD(P)H-flavin oxidoreductase
    • nitroreductase family protein
    • putative NAD(P)H-flavin oxidoreductase
    • FMN reductase
    • NAD(P)H-flavin oxidoreductase, putative
    • NADPH-dependent FMN reductase
    • nitro/flavin reductase
    • nitroreductase
  • strand?: +
  • coordinates?: 2450623..2451430
  • synteny block?: BlockID0013370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0381
    08BA02176:
    C248_0438
    11819-97:
    MS7_0372 (nfrA)
    71193:
    ST398NM01_0460
    ECT-R 2:
    ECTR2_342
    ED133:
    SAOV_0405
    ED98:
    SAAV_0349
    HO 5096 0412:
    SAEMRSA15_03350
    JH1:
    SaurJH1_0441
    JH9:
    SaurJH9_0430
    JKD6008:
    SAA6008_00382
    JKD6159:
    SAA6159_00357
    LGA251:
    SARLGA251_03430
    M013:
    M013TW_0362
    MRSA252:
    SAR0400
    MSHR1132:
    SAMSHR1132_03540
    MSSA476:
    SAS0359
    Mu3:
    SAHV_0379
    Mu50:
    SAV0382
    MW2:
    MW0358
    RF122:
    SAB0332
    ST398:
    SAPIG0460
    T0131:
    SAT0131_00415
    TCH60:
    HMPREF0772_10113
    TW20:
    SATW20_04490
    USA300_TCH1516:
    USA300HOU_0405
    VC40:
    SAVC_01665

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSEHVYNLVKKHHSVRKFKNKPLSEDVVKKLVEAGQSASTSSFLQAYSIIGIDDEKIKEN
    N315            MSDYVYNLVKKHHSVRKFKNKPLSEDVVKKLVEAGQSASTSSFLQAYSIIGIDDEKIKEN
    NCTC8325        MSEHVYNLVKKHHSVRKFKNKPLSEDVVKKLVEAGQSASTSSFLQAYSIIGIDDEKIKEN
    Newman          MSEHVYNLVKKHHSVRKFKNKPLSEDVVKKLVEAGQSASTSSFLQAYSIIGIDDEKIKEN
    USA300_FPR3757  MSEHVYNLVKKHHSVRKFKNKPLSEDVVKKLVEAGQSASTSSFLQAYSIIGIDDEKIKEN
                    **::********************************************************

    COL             LREVSGQPYVVENGYLFVFVIDYYRHHLVDQHAETDMENAYGSTEGLLVGAIDAALVAEN
    N315            LREVSGQPYVVENGYLFVFVIDYYRHHLVDQHAETDMENAYGSTEGLLVGAIDAALVAEN
    NCTC8325        LREVSGQPYVVENGYLFVFVIDYYRHHLVDQHAETDMENAYGSTEGLLVGAIDAALVAEN
    Newman          LREVSGQPYVVENGYLFVFVIDYYRHHLVDQHAETDMENAYGSTEGLLVGAIDAALVAEN
    USA300_FPR3757  LREVSGQPYVVENGYLFVFVIDYYRHHLVDQHAETDMENAYGSTEGLLVGAIDAALVAEN
                    ************************************************************

    COL             IAVTAEDMGYGIVFLGSLRNDVERVREILDLPDYVFPVFGMAVGEPADDENGAAKPRLPF
    N315            IAVTAEDMGYGIVFLGSLRNDVERVREILDLPDYVFPVFGMAVGEPADDENGAAKPRLPF
    NCTC8325        IAVTAEDMGYGIVFLGSLRNDVERVREILDLPDYVFPVFGMAVGEPADDENGAAKPRLPF
    Newman          IAVTAEDMGYGIVFLGSLRNDVERVREILDLPDYVFPVFGMAVGEPADDENGAAKPRLPF
    USA300_FPR3757  IAVTAEDMGYGIVFLGSLRNDVERVREILDLPDYVFPVFGMAVGEPADDENGAAKPRLPF
                    ************************************************************

    COL             DHVFHHNKYHADKETQYAQMADYDQTISEYYDQRTNGNRKETWSQQIEMFLGNKARLDML
    N315            DHVFHHNKYHADKETQYAQMADYDQTISEYYDQRTNGNRKETWSQQIEMFLGNKARLDML
    NCTC8325        DHVFHHNKYHADKETQYAQMADYDQTISEYYDQRTNGNRKETWSQQIEMFLGNKARLDML
    Newman          DHVFHHNKYHADKETQYAQMADYDQTISEYYDQRTNGNRKETWSQQIEMFLGNKARLDML
    USA300_FPR3757  DHVFHHNKYHADKETQYAQMADYDQTISEYYDQRTNGNRKETWSQQIEMFLGNKARLDML
                    ************************************************************

    COL             EQLQKSGLIQR
    N315            EQLQKSGLIQR
    NCTC8325        EQLQKSGLIQR
    Newman          EQLQKSGLIQR
    USA300_FPR3757  EQLQKSGLIQR
                    ***********