From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001990000
  • symbol?:
  • description?: putative DNA-binding protein
  • strand?: -
  • coordinates?: 2455559..2456868
  • synteny block?: BlockID0013430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0383
    08BA02176:
    C248_0441
    11819-97:
    MS7_0374
    71193:
    ST398NM01_0462
    ECT-R 2:
    ECTR2_344
    ED133:
    SAOV_0407c
    ED98:
    SAAV_0351
    HO 5096 0412:
    SAEMRSA15_03370
    JH1:
    SaurJH1_0443
    JH9:
    SaurJH9_0432
    JKD6008:
    SAA6008_00384
    JKD6159:
    SAA6159_00359
    LGA251:
    SARLGA251_03450
    M013:
    M013TW_0364
    MRSA252:
    SAR0403
    MSHR1132:
    SAMSHR1132_03560
    MSSA476:
    SAS0361
    Mu3:
    SAHV_0382
    Mu50:
    SAV0385
    MW2:
    MW0361
    RF122:
    SAB0335c
    ST398:
    SAPIG0462
    T0131:
    SAT0131_00417 (capB)
    TCH60:
    HMPREF0772_10109
    TW20:
    SATW20_04510
    USA300_TCH1516:
    USA300HOU_0408
    VC40:
    SAVC_01675

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLTKEFAQRVELSEKQVRKIVQHLEERGYQLSKTEYRGREATDFKEEDIELFKDIADKVK
    N315            MLTKEFAQRVELSEKQVRKIVQHLEERGYQLSKTEYRGREATDFKEEDIELFKDIADKVK
    NCTC8325        MLTKEFAQRVELSEKQVRKIVQHLEERGYQLSKTEYRGREATDFKEEDIELFKDIADKVK
    Newman          MLTKEFAQRVELSEKQVRKIVQHLEERGYQLSKTEYRGREATDFKEEDIELFKDIADKVK
    USA300_FPR3757  MLTKEFAQRVELSEKQVRKIVQHLEERGYQLSKTEYRGREATDFKEEDIELFKDIADKVK
                    ************************************************************

    COL             QTNSYDLAFDELEKEKDFLQVIVKNDDKNLPTNQNVAQLVEDLRLEIQKMREERHLLGQM
    N315            QTNSYDLAFDELEKEKDFLQVIVKNDDKNLPTNQNVAQLVEDLRLEIQKMREERHLLGQM
    NCTC8325        QTNSYDLAFDELEKEKDFLQVIVKNDDKNLPTNQNVAQLVEDLRLEIQKMREERHLLGQM
    Newman          QTNSYDLAFDELEKEKDFLQVIVKNDDKNLPTNQNVAQLVEDLRLEIQKMREERHLLGQM
    USA300_FPR3757  QTNSYDLAFDELEKEKDFLQVIVKNDDKNLPTNQNVAQLVEDLRLEIQKMREERHLLGQM
                    ************************************************************

    COL             MNQVHQQQQELKELQNQLTSKIDSNSESLKAIQTSQEAIQEAQASQAKALAESTNKVEKN
    N315            MNQVHQQQQELKELQNQLTSKIDSNSESLKAIQTSQEAIQEAQASQAKVLAESTNKVEKN
    NCTC8325        MNQVHQQQQELKELQNQLTSKIDSNSESLKAIQTSQEAIQEAQASQAKALAESTNKVEKN
    Newman          MNQVHQQQQELKELQNQLTSKIDSNSESLKAIQTSQEAIQEAQASQAKALAESTNKVEKN
    USA300_FPR3757  MNQVHQQQQELKELQNQLTSKIDSNSESLKAIQTSQEAIQEAQASQAKALAESTNKVEKN
                    ************************************************.***********

    COL             AVTEDKADSKDSKVAGVNTSTDAKTDTKAENAGDGTATKVDKEDQISATEAIEKASVEQS
    N315            AVTEDKADSKDSKVAGVNTSTDAKTDTKAENAGDGTATKVDKEDQISATEAIEKASVEQS
    NCTC8325        AVTEDKADSKDSKVAGVNTSTDAKTDTKAENAGDGTATKVDKEDQISATEAIEKASVEQS
    Newman          AVTEDKADSKDSKVAGVNTSTDAKTDTKAENAGDGTATNVDKEDQISATEAIEKASVEQS
    USA300_FPR3757  AVTEDKADSKDSKVAGVNTSTDAKTDTKAENAGDGTATKVDKEDQISATEAIEKASVEQS
                    **************************************:*********************

    COL             KNDNAAETSNKEATVDAEAQHDAEQQVAEAHAEASKQATSNDSLEAKAENDSTASQSEMS
    N315            KNENAAETSNKEATVDADAQHDAEQQVAEAHAEASKQATSNDSLEAKAENDSTASQSEMS
    NCTC8325        KNDNAAETSNKEATVDAEAQHDAEQQVAEAHAEASKQATSNDSLEAKAENDSTASQSEMS
    Newman          KNDNAAETSNKEATVDAEAQHDAEQQVAEAHAEASKQATSNDSLEAKAENDSTASQSEMS
    USA300_FPR3757  KNDNAAETSNKEATVDAEAQHDAEQQVAEAHAEASKQATSNDSLEAKAENDSTASQSEMS
                    **:**************:******************************************

    COL             EPKPQEEKKGFFARLFNL
    N315            EPKPQEEKKGFFARLFNL
    NCTC8325        EPKPQEEKKGFFARLFNL
    Newman          EPKPQEEKKGFFARLFNL
    USA300_FPR3757  EPKPQEEKKGFFARLFNL
                    ******************