From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001991000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 2456986..2457648
  • synteny block?: BlockID0013440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0384
    08BA02176:
    C248_0442
    11819-97:
    MS7_0375
    71193:
    ST398NM01_0463
    ECT-R 2:
    ECTR2_345
    ED133:
    SAOV_0408c
    ED98:
    SAAV_0352
    HO 5096 0412:
    SAEMRSA15_03380
    JH1:
    SaurJH1_0444
    JH9:
    SaurJH9_0433
    JKD6008:
    SAA6008_00385
    JKD6159:
    SAA6159_00360
    LGA251:
    SARLGA251_03460
    M013:
    M013TW_0365
    MRSA252:
    SAR0404
    MSHR1132:
    SAMSHR1132_03570
    MSSA476:
    SAS0362
    Mu3:
    SAHV_0383
    Mu50:
    SAV0386
    MW2:
    MW0362
    RF122:
    SAB0336c
    ST398:
    SAPIG0463
    T0131:
    SAT0131_00418 (capC)
    TCH60:
    HMPREF0772_10108
    TW20:
    SATW20_04520
    USA300_TCH1516:
    USA300HOU_0409
    VC40:
    SAVC_01680

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEFKTIQSVKDPHYNEALKLYDTKLNLSLTEDKRIIKRSLENNKTENDYVFIVGLENDVV
    N315            MEFKTIQSVKDPHYNEALKLYDTKLNLSLTEDKRIIKRSLENNKTENDYVFIVGLENDVV
    NCTC8325        MEFKTIQSVKDPHYNEALKLYDTKLNLSLTEDKRIIKRSLENNKTENDYVFIVGLENDVV
    Newman          MEFKTIQSVKDPHYNEALKLYDTKLNLSLTEDKRIIKRSLENNKTENDYVFIVGLENDVV
    USA300_FPR3757  MEFKTIQSVKDPHYNEALKLYDTKLNLSLTEDKRIIKRSLENNKTENDYVFIVGLENDVV
                    ************************************************************

    COL             VSLATAHYEATTNSAFLIYLFAKDLPNHDELMTQTLHQIEHELNLLSNLVHSRSINFLMM
    N315            VSLATAHYEATTNSAFLIYLFAKDLPNHDELMTQTLHQIEHELNLLSNLVHSRSINFLMM
    NCTC8325        VSLATAHYEATTNSAFLIYLFAKDLPNHDELMTQTLHQIEHELNLLSNLVHSRSINFLMM
    Newman          VSLATAHYEATTNSAFLIYLFAKDLPNHDELMTQTLHQIEHELNLLSNLVHSRSINFLMM
    USA300_FPR3757  VSLATAHYEATTNSAFLIYLFAKDLPNHDELMTQTLHQIEHELNLLSNLVHSRSINFLMM
                    ************************************************************

    COL             EVPKEPADLTQDNGLIIEHRRQFLYEHQFERQTEIDYIHPTNDGHTKKVDLFLKKNIKLT
    N315            EVPKEPADLTQDNGLIIEHRRQFLYEHQFERQTEIDYIHPTNDGHTKKVDLFLKKNIKLT
    NCTC8325        EVPKEPADLTQDNGLIIEHRRQFLYEHQFERQTEIDYIHPTNDGHTKKVDLFLKKNIKLT
    Newman          EVPKEPADLTQDNGLIIEHRRQFLYEHQFERQTEIDYIHPTNDGHTKKVDLFLKKNIKLT
    USA300_FPR3757  EVPKEPADLTQDNGLIIEHRRQFLYEHQFERQTEIDYIHPTNDGHTKKVDLFLKKNIKLT
                    ************************************************************

    COL             KDIYGTSVKSNYILKYVFANGIAREIIYALLEEMDLRKPF
    N315            KDIYGTSVKSNYILKYVFANGIAREIIYALLEEMDLRKPF
    NCTC8325        KDIYGTSVKSNYILKYVFANGIAREIIYALLEEMDLRKPF
    Newman          KDIYGTSVKSNYILKYVFANGIAREIIYALLEEMDLRKPF
    USA300_FPR3757  KDIYGTSVKSNYILKYVFANGIAREIIYALLEEMDLRKPF
                    ****************************************