From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002101000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • membrane spanning protein
  • strand?: -
  • coordinates?: 2586366..2586668
  • synteny block?: BlockID0014070
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0394
    08BA02176:
    C248_0469
    11819-97:
    MS7_0395
    71193:
    ST398NM01_0488
    ECT-R 2:
    ECTR2_355
    ED133:
    SAOV_0438c
    ED98:
    SAAV_0363
    HO 5096 0412:
    SAEMRSA15_03510
    JH1:
    SaurJH1_0455
    JH9:
    SaurJH9_0443
    JKD6008:
    SAA6008_00420
    JKD6159:
    SAA6159_00373
    LGA251:
    SARLGA251_03580
    M013:
    M013TW_0380
    MRSA252:
    SAR0420
    MSHR1132:
    SAMSHR1132_03700
    MSSA476:
    SAS0382
    Mu3:
    SAHV_0417
    Mu50:
    SAV0420
    MW2:
    MW0380
    RF122:
    SAB0373c
    ST398:
    SAPIG0488
    T0131:
    SAT0131_00455
    TCH60:
    HMPREF0772_10097
    TW20:
    SATW20_04940
    USA300_TCH1516:
    USA300HOU_0420
    VC40:
    SAVC_01725

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNIISTILIIFVALEFFYIMYLETIATTSKKTSETFNISVDKLKDKNINLLLKNQGVYNG
    N315            MNIISTILIIFVALEFFYIMYLETIATTSKKTSETFNISVDKLKDKNINLLLKNQGVYNG
    NCTC8325        MNIISTILIIFVALEFFYIMYLETIATTSKKTSETFNISVDKLKDKNINLLLKNQGVYNG
    Newman          MNIISTILIIFVALEFFYIMYLETIATTSKKTSETFNISVDKLKDKNINLLLKNQGVYNG
    USA300_FPR3757  MNIISTILIIFVALEFFYIMYLETIATTSKKTSETFNISVDKLKDKNINLLLKNQGVYNG
                    ************************************************************

    COL             LIGVLLIYGLFISSNPKEICAAILVYIIGVAIYGGLSSNISIFFKQGTLPVLALISMLW
    N315            LIGVLLIYGLFISSNPKEICTAILVYIIGVAIYGGLSSNISIFFKQGTLPVLALISMLW
    NCTC8325        LIGVLLIYGLFISSNPKEICAAILVYIIGVAIYGGLSSNISIFFKQGTLPVLALISMLW
    Newman          LIGVLLIYGLFISSNPKEICAAILVYIIGVAIYGGLSSNISIFFKQGTLPVLALISMLW
    USA300_FPR3757  LIGVLLIYGLFISSNPKEICAAILVYIIGVAIYGGLSSNISIFFKQGTLPVLALISMLW
                    ********************:**************************************