From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002102000
  • symbol?:
  • description?: 3-beta hydroxysteroid dehydrogenase/isomerase family protein

      descriptions from strain specific annotations:

    • 3-beta hydroxysteroid dehydrogenase/isomerase family protein
    • FAD/NAD(P)-binding Rossmann fold superfamily protein
    • NAD dependent epimerase/dehydratase family protein
    • cobalt (Co2+) ABC superfamily ATP binding cassette transporter, membrane protein
    • Nucleoside-diphosphate-sugar epimerase
    • putative nucleoside-diphosphate-sugar epimerase
    • oxidoreductase
  • strand?: -
  • coordinates?: 2586744..2587589
  • synteny block?: BlockID0014080
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0395
    08BA02176:
    C248_0470
    11819-97:
    MS7_0396
    71193:
    ST398NM01_0489
    ECT-R 2:
    ECTR2_356
    ED133:
    SAOV_0439c
    ED98:
    SAAV_0364
    HO 5096 0412:
    SAEMRSA15_03520
    JH1:
    SaurJH1_0456
    JH9:
    SaurJH9_0444
    JKD6008:
    SAA6008_00421
    JKD6159:
    SAA6159_00374
    LGA251:
    SARLGA251_03590
    M013:
    M013TW_0381
    MRSA252:
    SAR0421
    MSHR1132:
    SAMSHR1132_03710
    MSSA476:
    SAS0383
    Mu3:
    SAHV_0418
    Mu50:
    SAV0421
    MW2:
    MW0381
    RF122:
    SAB0374c
    ST398:
    SAPIG0489
    T0131:
    SAT0131_00456 (argJ)
    TCH60:
    HMPREF0772_10096
    TW20:
    SATW20_04950
    USA300_TCH1516:
    USA300HOU_0421
    VC40:
    SAVC_01730

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNIMLTGATGHLGTHITNQAIANHIDHFHIGVRNVEKVPEDWRGKVPVRQLDYFNQESMV
    N315            MNIMLTGATGHLGTHITNQAIANHIDHFHIGVRNVEKVPDDWRGKVSVRQLDYFNQESMV
    NCTC8325        MNIMLTGATGHLGTHITNQAIANHIDHFHIGVRNVEKVPEDWRGKVPVRQLDYFNQESMV
    Newman          MNIMLTGATGHLGTHITNQAIANHIDHFHIGVRNVEKVPEDWRGKVPVRQLDYFNQESMV
    USA300_FPR3757  MNIMLTGATGHLGTHITNQAIANHIDHFHIGVRNVEKVPEDWRGKVPVRQLDYFNQESMV
                    ***************************************:******.*************

    COL             EAFKGMDTVVFIPSIIHPSFKRIPEVENLVYAAKQSGVAHIIFIGYYADQHNNPFHMSPY
    N315            EAFKGMDTVVFIPSIIHPSFKRIPEVENLVYAAKQSGVAHIIFIGYYADQHNNPFHMSPY
    NCTC8325        EAFKGMDTVVFIPSIIHPSFKRIPEVENLVYAAKQSGVAHIIFIGYYADQHNNPFHMSPY
    Newman          EAFKGMDTVVFIPSIIHPSFKRIPEVENLVYAAKQSGVAHIIFIGYYADQHNNPFHMSPY
    USA300_FPR3757  EAFKGMDTVVFIPSIIHPSFKRIPEVENLVYAAKQSGVAHIIFIGYYADQHNNPFHMSPY
                    ************************************************************

    COL             FGYAARLLATSGIDYTYVRMAMYMDPLKPYLPELMNMHKLIYPAGDGRINYITRNDIARG
    N315            FGYASRLLSTSGIDYTYVRMAMYMDPLKPYLPELMNMHKLIYPAGDGRINYITRNDIARG
    NCTC8325        FGYAARLLATSGIDYTYVRMAMYMDPLKPYLPELMNMHKLIYPAGDGRINYITRNDIARG
    Newman          FGYAARLLATSGIDYTYVRMAMYMDPLKPYLPELMNMHKLIYPAGDGRINYITRNDIARG
    USA300_FPR3757  FGYAARLLATSGIDYTYVRMAMYMDPLKPYLPELMNMHKLIYPAGDGRINYITRNDIARG
                    ****:***:***************************************************

    COL             VIAIIKNPDTWGKRYLLSGYSYDMKELAAILSEASGTEIKYEPVSLETFAEMYDEPKGFG
    N315            VIAIIKNPDTWGKRYLLSGYSYDMKELAAILSEASGTEIKYEPVSLETFAEMYDEPKGFG
    NCTC8325        VIAIIKNPDTWGKRYLLSGYSYDMKELAAILSEASGTEIKYEPVSLETFAEMYDEPKGFG
    Newman          VIAIIKNPDTWGKRYLLSGYSYDMKELAAILSEASGTEIKYEPVSLETFAEMYDEPKGFG
    USA300_FPR3757  VIAIIKNPDTWGKRYLLSGYSYDMKELAAILSEASGTEIKYEPVSLETFAEMYDEPKGFG
                    ************************************************************

    COL             ALLASMYDAGARGLLDQESNDFQQLVNDQPQTLQSFLQENI
    N315            ALLASMYHAGARGLLDQESNDFKQLVNDQPQTLQSFLQENI
    NCTC8325        ALLASMYDAGARGLLDQESNDFQQLVNDQPQTLQSFLQENI
    Newman          ALLASMYDAGARGLLDQESNDFQQLVNDQPQTLQSFLQENI
    USA300_FPR3757  ALLASMYDAGARGLLDQESNDFQQLVNDQPQTLQSFLQENI
                    *******.**************:******************