From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002104000
  • symbol?: ssl1
  • description?: staphylococcal superantigen-like protein 1
  • strand?: +
  • coordinates?: 2587971..2588748
  • synteny block?: BlockID0014100
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0382 (set6)
    NCTC8325:
    Newman:
    NWMN_0388 (set1nm)
    USA300_FPR3757:
    04-02981:
    SA2981_0396 (set6)
    08BA02176:
    C248_0472 (set6)
    11819-97:
    MS7_0397
    71193:
    ST398NM01_0490
    ECT-R 2:
    ECTR2_357
    ED133:
    SAOV_0440
    ED98:
    SAAV_0365
    HO 5096 0412:
    SAEMRSA15_03530
    JH1:
    SaurJH1_0457
    JH9:
    SaurJH9_0445
    JKD6008:
    SAA6008_00422 (set6)
    JKD6159:
    SAA6159_00375
    LGA251:
    SARLGA251_03600
    M013:
    M013TW_0382
    MRSA252:
    SAR0422
    MSHR1132:
    SAMSHR1132_03720
    MSSA476:
    SAS0384
    Mu3:
    SAHV_0419 (set6)
    Mu50:
    SAV0422 (set6)
    MW2:
    MW0382 (set16)
    RF122:
    SAB0376 (set11)
    ST398:
    SAPIG0490
    T0131:
    SAT0131_00457
    TCH60:
    HMPREF0772_10095
    TW20:
    SATW20_04960
    USA300_TCH1516:
    USA300HOU_0422 (set3)
    VC40:
    SAVC_01735

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFKAIAKASLALGMLATGVITSNVQSVQAKAEVKQQSESELKHYYNKPILERKNVTGFK
    N315            MKFKAIAKASLALGMLATGVITSNVQSVQAKTEVKQQSESELKHYYNKPVLERKNVTGYK
    NCTC8325        MKFKAIAKASLALGMLATGVITSNVQSVQAKAEVKQQSESELKHYYNKPILERKNVTGFK
    Newman          MKFKAIAKASLALGMLATGVITSNVQSVQAKAEVKQQSESELKHYYNKPILERKNVTGFK
    USA300_FPR3757  MKFKAIAKASLALGMLATGVITSNVQSVQAKAEVKQQSESELKHYYNKPILERKNVTGFK
                    *******************************:*****************:********:*

    COL             YTDEGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVT
    N315            YTEKGKDYIDVIVDNQYSQISLVGSDKDKFKDGDNSNIDVFILREGDSRQATNYSIGGVT
    NCTC8325        YTDEGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVT
    Newman          YTDEGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVT
    USA300_FPR3757  YTDEGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVT
                    **::**.*::* *.:*:*:*:*:**********:**************************

    COL             KSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLKELDYRLRERAIKQHGLYSNG
    N315            KTNSQPFIDYIHTPILEIKKGKEEPQSSLYQIYKEDISLKELDYRLRERAIKQHGLYSNG
    NCTC8325        KSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLKELDYRLRERAIKQHGLYSNG
    Newman          KSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLKELDYRLRERAIKQHGLYSNG
    USA300_FPR3757  KSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLKELDYRLRERAIKQHGLYSNG
                    *:**  :****:********.:*:  ..:* * ***************************

    COL             LKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK
    N315            LKQGQITITMKDGKSHTIDLSQKLEKERMGDSIDGRQIQKILVEMK
    NCTC8325        LKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK
    Newman          LKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK
    USA300_FPR3757  LKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK
                    **********:**.:***************:**** :*:*******