From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002108000
  • symbol?: ssl3
  • description?: staphylococcal superantigen-like protein 3

      descriptions from strain specific annotations:

    • staphylococcal superantigen-like protein 3
    • superantigen-like protein
    • exotoxin
    • Exotoxin 8
    • staphylococcal/Streptococcal toxin, beta-grasp domain protein
    • Staphylococcal enterotoxin-like toxin
    • staphylococcal exotoxin
    • superantigen-like protein 11
  • strand?: +
  • coordinates?: 2590789..2592102
  • synteny block?: BlockID0014140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0384 (set8)
    NCTC8325:
    Newman:
    NWMN_0390 (set3nm)
    USA300_FPR3757:
    04-02981:
    SA2981_0398 (set8)
    08BA02176:
    C248_0475
    11819-97:
    MS7_0399
    71193:
    ST398NM01_0493
    ECT-R 2:
    ECTR2_359
    ED133:
    SAOV_0442
    ED98:
    SAAV_0367
    HO 5096 0412:
    SAEMRSA15_03550
    JH1:
    SaurJH1_0459
    JH9:
    SaurJH9_0447
    JKD6008:
    SAA6008_00424 (set8)
    JKD6159:
    SAA6159_00377
    LGA251:
    SARLGA251_03620
    M013:
    M013TW_0385
    MRSA252:
    SAR0425
    MSHR1132:
    SAMSHR1132_03740
    MSSA476:
    SAS0386
    Mu3:
    SAHV_0421 (set8)
    Mu50:
    SAV0424 (set8)
    MW2:
    MW0384 (set18)
    RF122:
    SAB0378 (set9)
    ST398:
    SAPIG0493
    T0131:
    SAT0131_00460
    TCH60:
    HMPREF0772_10092
    TW20:
    SATW20_04980
    USA300_TCH1516:
    USA300HOU_0424 (set18)
    VC40:
    SAVC_01745

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKMRTIAKTSLALGLLTTGAITVTTQSVKAEKIQSTKVDKVPTLKAERLAMINITAGANS
    N315            MNMKTIAKTSLALGLLTTGAITVTTQSVKAEKIQSTKVDKVPTLKAERLAMINITAGANS
    NCTC8325        MKMRTIAKTSLALGLLTTGAITVTTQSVKAEKIQSTKVDKVPTLKAERLAMINITAGANS
    Newman          MKMRTIAKTSLALGLLTTGAITVTTQSVKAEKIQSTKVDKVPTLKAERLAMINITAGANS
    USA300_FPR3757  MKMRTIAKTSLALGLLTTGAITVTTQSVKAEKIQSTKVDKVPTLKAERLAMINITAGANS
                    *:*:********************************************************

    COL             ATTQAANTRQERTPKLEKAPNTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQ
    N315            ATTQAANTRQERTPKLEKAPNTNEEKTSASKIEKISQPKQEEQKSLNISATPAPKQEQSQ
    NCTC8325        ATTQAANTRQERTPKLEKAPNTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQ
    Newman          ATTQAANTRQERTPKLEKAPNTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQ
    USA300_FPR3757  ATTQAANTRQERTPKLEKAPNTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQ
                    ********************************************:***************

    COL             TTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQAQTDMTPKYEDLRAYYTKPSF
    N315            TTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQAQTDMTPKYEDLRAYYTKPSF
    NCTC8325        TTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQAQTDMTPKYEDLRAYYTKPSF
    Newman          TTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQAQTDMTPKYEDLRAYYTKPSF
    USA300_FPR3757  TTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQAQTDMTPKYEDLRAYYTKPSF
                    ************************************************************

    COL             EFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ
    N315            EFEKQFGFLLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ
    NCTC8325        EFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ
    Newman          EFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ
    USA300_FPR3757  EFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ
                    ********:***************************************************

    COL             LKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQ
    N315            LKKYSVGGITKTNSKKVDHKAELSVTKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQ
    NCTC8325        LKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQ
    Newman          LKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQ
    USA300_FPR3757  LKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQ
                    *****************:**.***:***********************************

    COL             LIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMA----GTNIDNIEVNIK
    N315            LIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMADVIEGTNIDKIEVNIK
    NCTC8325        LIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK
    Newman          LIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMA----GTNIDNIEVNIK
    USA300_FPR3757  LIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMA----GTNIDNIEVNIK
                    ****************************************    *****:******