From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002119000
  • symbol?: ssl10
  • description?: staphylococcal superantigen-like protein 10

      descriptions from strain specific annotations:

    • staphylococcal superantigen-like protein 10
    • superantigen-like protein
    • exotoxin 4
    • Exotoxin 14
    • exotoxin 5
    • staphylococcal/Streptococcal toxin, beta-grasp domain protein
    • Staphylococcal enterotoxin-like toxin
    • staphylococcal exotoxin
    • superantigen-like protein, exotoxin 14
  • strand?: +
  • coordinates?: 2610769..2611452
  • synteny block?: BlockID0014250
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0390 (set14)
    NCTC8325:
    Newman:
    NWMN_0397 (set10nm)
    USA300_FPR3757:
    04-02981:
    SA2981_0405 (set14)
    08BA02176:
    C248_0481 (set4)
    11819-97:
    MS7_0405
    71193:
    ST398NM01_0498
    ECT-R 2:
    ECTR2_365
    ED133:
    SAOV_0450
    ED98:
    SAAV_0373
    HO 5096 0412:
    SAEMRSA15_03600 (set4)
    JH1:
    SaurJH1_0465
    JH9:
    SaurJH9_0453
    JKD6008:
    SAA6008_00433 (set14)
    JKD6159:
    LGA251:
    SARLGA251_03680 (set4)
    M013:
    M013TW_0391
    MRSA252:
    SAR0431 (set4)
    MSHR1132:
    MSSA476:
    SAS0393
    Mu3:
    SAHV_0427 (set14)
    Mu50:
    SAV0429 (set14)
    MW2:
    MW0391 (set25)
    RF122:
    SAB0383 (set2)
    ST398:
    SAPIG0498
    T0131:
    SAT0131_00469
    TCH60:
    HMPREF0772_10087 (set4)
    TW20:
    SATW20_05060 (set4)
    USA300_TCH1516:
    USA300HOU_0432 (set25)
    VC40:
    SAVC_01780

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFTALAKATLALGILTTGTLTTEVHSGHAKQNQKSVNKHDKEALYRYYTGKTMEMKNIS
    N315            MKFTALAKATLALGILTTGTLTTEVHSGHAKQNQKSVNKHDKEALYRYYTGKTMEMKNIS
    NCTC8325        MKFTALAKATLALGILTTGTLTTEVHSGHAKQNQKSVNKHDKEALYRYYTGKTMEMKNIS
    Newman          MKFTALAKATLALGILTTGTLTTEVHSGHAKQNQKSVNKHDKEALYRYYTGKTMEMKNIS
    USA300_FPR3757  MKFTALAKATLALGILTTGTLTTEVHSGHAKQNQKSVNKHDKEALYRYYTGKTMEMKNIS
                    ************************************************************

    COL             ALKHGKNNLRFKFRGIKIQVLLPGNDKSKFQQRSYEGLDVFFVQEKRDKHDIFYTVGGVI
    N315            ALKHGKNNLRFKFRGIKIQVLLPGNDKSKFQQRSYEGLDVFFVQEKRDKHDIFYTVGGVI
    NCTC8325        ALKHGKNNLRFKFRGIKIQVLLPGNDKSKFQQRSYEGLDVFFVQEKRDKHDIFYTVGGVI
    Newman          ALKHGKNNLRFKFRGIKIQVLLPGNDKSKFQQRSYEGLDVFFVQEKRDKHDIFYTVGGVI
    USA300_FPR3757  ALKHGKNNLRFKFRGIKIQVLLPGNDKSKFQQRSYEGLDVFFVQEKRDKHDIFYTVGGVI
                    ************************************************************

    COL             QNNKTSGVVSAPILNISKEKGEDAFVKGYPYYIKKEKITLKELDYKLRKHLIEKYGLYKT
    N315            QNNKTSGVVSAPILNISKEKGEDAFVKGYPYYIKKEKITLKELDYKLRKHLIEKYGLYKT
    NCTC8325        QNNKTSGVVSAPILNISKEKGEDAFVKGYPYYIKKEKITLKELDYKLRKHLIEKYGLYKT
    Newman          QNNKTSGVVSAPILNISKEKGEDAFVKGYPYYIKKEKITLKELDYKLRKHLIEKYGLYKT
    USA300_FPR3757  QNNKTSGVVSAPILNISKEKGEDAFVKGYPYYIKKEKITLKELDYKLRKHLIEKYGLYKT
                    ************************************************************

    COL             ISKDGRVKISLKDGSFYNLDLRSKLKFKYMGEVIESKQIKDIEVNLK
    N315            ISKDGRVKISLKDGSFYNLDLRSKLKFKYMGEVIESKQIKDIEVNLK
    NCTC8325        ISKDGRVKISLKDGSFYNLDLRSKLKFKYMGEVIESKQIKDIEVNLK
    Newman          ISKDGRVKISLKDGSFYNLDLRSKLKFKYMGEVIESKQIKDIEVNLK
    USA300_FPR3757  ISKDGRVKISLKDGSFYNLDLRSKLKFKYMGEVIESKQIKDIEVNLK
                    ***********************************************