From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002129000
  • symbol?: ssl11
  • description?: staphylococcal superantigen-like protein 11

      descriptions from strain specific annotations:

    • staphylococcal superantigen-like protein 11
    • superantigen-like protein
    • Exotoxin 15
    • exotoxin
    • Exotoxin type C
    • staphylococcal/Streptococcal toxin, beta-grasp domain protein
    • Staphylococcal enterotoxin-like toxin
    • staphylococcal exotoxin
  • strand?: +
  • coordinates?: 2623073..2623774
  • synteny block?: BlockID0014350
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0393 (set15)
    NCTC8325:
    Newman:
    NWMN_0400 (set11nm)
    USA300_FPR3757:
    04-02981:
    SA2981_0409 (set15)
    08BA02176:
    C248_0484
    11819-97:
    MS7_0408 (set15)
    71193:
    ST398NM01_0501
    ECT-R 2:
    ECTR2_368
    ED133:
    SAOV_0453
    ED98:
    SAAV_0376
    HO 5096 0412:
    SAEMRSA15_03630
    JH1:
    SaurJH1_0468
    JH9:
    SaurJH9_0456
    JKD6008:
    SAA6008_00436 (set15)
    JKD6159:
    LGA251:
    SARLGA251_03710
    M013:
    M013TW_0394
    MRSA252:
    SAR0435
    MSHR1132:
    MSSA476:
    SAS0396
    Mu3:
    SAHV_0431 (set15)
    Mu50:
    SAV0433 (set15)
    MW2:
    MW0394 (set26)
    RF122:
    SAB0386 (set1)
    ST398:
    SAPIG0501
    T0131:
    SAT0131_00472 (tyrS)
    TCH60:
    HMPREF0772_10084
    TW20:
    SATW20_05100
    USA300_TCH1516:
    USA300HOU_0435 (set)
    VC40:
    SAVC_01795

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLKNIAKASLALGILTTGMITTTAQPVKASTLEVRSQATQDLSEYYNRPFFEYTNQSGY
    N315            MKLKNIAKASLALGILTTGMITTTAQPVKASTLEVRSQATQDLSEYYKGRGFELTNVTGY
    NCTC8325        MKLKNIAKASLALGILTTGMITTTAQPVKASTLEVRSQATQDLSEYYNRPFFEYTNQSGY
    Newman          MKLKNIAKASLALGILTTGMITTTAQPVKASTLEVRSQATQDLSEYYNRPFFEYTNQSGY
    USA300_FPR3757  MKLKNIAKASLALGILTTGMITTTAQPVKASTLEVRSQATQDLSEYYNRPFFEYTNQSGY
                    ***********************************************:   ** ** :**

    COL             KEEGKVTFTPNYQLIDVTLTGNEKQNFGED--ISNVDIFVVRENSDRSGNTASIGGITKT
    N315            KYGNKVTFIDNSQQIDVTLTGNEKLTVKDDDEVSNVDVFVVREGSDKSAITTSIGGITKT
    NCTC8325        KEEGKVTFTPNYQLIDVTLTGNEKQNFGED--ISNVDIFVVRENSDRSGNTASIGGITKT
    Newman          KEEGKVTFTPNYQLIDVTLTGNEKQNFGED--ISNVDIFVVRENSDRSGNTASIGGITKT
    USA300_FPR3757  KEEGKVTFTPNYQLIDVTLTGNEKQNFGED--ISNVDIFVVRENSDRSGNTASIGGITKT
                    *  .****  * * ********** .. :*  :****:*****.**:*. *:********

    COL             NGSNYIDKVKDVNLIITKNIDSVTSTSTSSTYTINKEEISLKELDFKLRKHLIDKHNLYK
    N315            NGTQHKDTVQNVNLSVSKSTGQHTTSVTSEYYSIYKEEISLKELDFKLRKHLIDKHDLYK
    NCTC8325        NGSNYIDKVKDVNLIITKNIDSVTSTSTSSTYTINKEEISLKELDFKLRKHLIDKHNLYK
    Newman          NGSNYIDKVKDVNLIITKNIDSVTSTSTSSTYTINKEEISLKELDFKLRKHLIDKHNLYK
    USA300_FPR3757  NGSNYIDKVKDVNLIITKNIDSVTSTSTSSTYTINKEEISLKELDFKLRKHLIDKHNLYK
                    **::: *.*::*** ::*. .. *:: **. *:* *********************:***

    COL             TEPKDSKIRITMKDGGFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
    N315            TEPKDSKIRITMKNGGYYTFELNKKLQPHRMGDTIDSRNIEKIEVNL
    NCTC8325        TEPKDSKIRITMKDGGFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
    Newman          TEPKDSKIRITMKDGGFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
    USA300_FPR3757  TEPKDSKIRITMKDGGFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
                    *************:**:**********.*****.**.**********