From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN002139000
  • symbol?: lpl5
  • description?: tandem-type lipoprotein

      descriptions from strain specific annotations:

    • tandem-type lipoprotein
    • tandem lipoprotein
    • putative lipoprotein
    • staphylococcus tandem lipoproteins family protein
    • Tandem lipoprotein within Pathogenicity island 2
  • strand?: +
  • coordinates?: 2642051..2642846
  • synteny block?: BlockID0014450
  • occurrence?: in 41% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0398 (lpl3)
    NCTC8325:
    Newman:
    NWMN_0408 (lpl5nm)
    USA300_FPR3757:
    04-02981:
    SA2981_0414 (lpl3)
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_373
    ED133:
    ED98:
    SAAV_0381
    HO 5096 0412:
    SAEMRSA15_03700
    JH1:
    SaurJH1_0473
    JH9:
    SaurJH9_0461
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0436 (lpl3)
    Mu50:
    SAV0438 (lpl3)
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0443
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MEYLKRLALLISVIILTIFIMGCDSQSDTAENPKEGSKEAQIKKSFSKTLDMYPIKNLE
    N315            MMGYSKRFALYISVMILIFAIAGCGKSDET----KEGSKEEQIKKSFAKTLDMYPIKNLE
    Newman          -MEYLKRLALLISVIILTIFIMGCDSQSDTAENPKEGSKEAQIKKSFSKTLDMYPIKNLE
    USA300_FPR3757  -MEYLKRLALLISVIILTIFIMGCDSQSDTAENPKEGSKEAQIKKSFSKTLDMYPIKNLE
                     * * **:** ***:** : * **....:*    ****** ******:************

    COL             DFYDKEGYRDGEFKKDDKGTWLIRSEIVKQPKGKVMKTRGMQLYINRNTETAKGFFVLKE
    N315            DLYDKEGYRDGEFKKGDKGTWVISSVMVKQPKGEIMKSRGMYLFLNRNTRTAKGYFIVDE
    Newman          DFYDKEGYRDGEFKKDDKGTWLIRSEIVKQPKGKVMKTRGMQLYINRNTETAKGFFVLKE
    USA300_FPR3757  DFYGKEGYRDGEFKKDDKGTWLIRSEIVKQPKGKVMKTRGMQLYINRNTETAKGFFVLKE
                    *:*.***********.*****:* * :******::**:*** *::****.****:*::.*

    COL             ISENNNRVNKDKEEKYEVKMVGNKIIPTEQINDEKIKKEIENFKFFVQYGNFKNFEKYNN
    N315            TSNDTLKKTEDKEKRYPVKMVNNKIVPIDPINDKGVKKEIENFKFFSQYGDFKELKNYKN
    Newman          ISENNNRVNKDKEEKYEVKMVGNKIIPTEQINDEKIKKEIENFKFFVQYGNFKNFEKYNN
    USA300_FPR3757  ISENNNRVNKDKEEKYEVKMVGNKIIPTEQINDEKIKKEIENFKFFVQYGNFKNFEKYNN
                     *::. : .:***::* ****.***:* : ***: :********** ***:**::::*:*

    COL             GEFSYNPEAPIYSAKYQLHNDDYNVRQLRKRYDISTKETPKLLLKGGGDLKNSSVGQNDI
    N315            GEVSYNSEAPIYSAKYQLKNNDYNVKQLRKRYDISTEKAPKLLLKGTGDLKGSSIGHKDI
    Newman          GEFSYNPEAPIYSAKYQLHNDDYNVRQLRKRYDISTKETPKLLLKGGGDLKNSSVGQNDI
    USA300_FPR3757  GEFSYNPEAPIYSAKYQLHNDDYNVRQLRKRYDISTKETPKLLLKGGGDLKNSSVGQNDI
                    **.***.***********:*:****:**********:::******* ****.**:*::**

    COL             EFTFVERKGENIYFNDSVEFIPSK--
    N315            EFTFVENQEENIFFTDSLEFTSSENY
    Newman          EFTFVERKGENIYFNDSVEFIPSK--
    USA300_FPR3757  EFTFVERKGENIYFNDSVEFIPSK--
                    ******.: ***:*.**:** .*: