From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN002142000
  • symbol?: lpl3
  • description?: tandem-type lipoprotein

      descriptions from strain specific annotations:

    • tandem-type lipoprotein
    • tandem lipoprotein
    • lipoprotein
    • Membrane lipoprotein
    • pseudogene
    • staphylococcal tandem lipoprotein
    • staphylococcus tandem lipoproteins family protein
    • Tandem lipoprotein within Pathogenicity island
  • strand?: +
  • coordinates?: 2644134..2645795
  • synteny block?: BlockID0014480
  • occurrence?: in 56% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0403 (lpl7)
    NCTC8325:
    Newman:
    NWMN_0406 (lpl3nm)
    USA300_FPR3757:
    04-02981:
    SA2981_0419 (lpl7)
    08BA02176:
    C248_0493
    11819-97:
    71193:
    ST398NM01_0509
    ECT-R 2:
    ECTR2_378
    ED133:
    ED98:
    SAAV_0386
    HO 5096 0412:
    JH1:
    SaurJH1_0478
    JH9:
    SaurJH9_0466
    JKD6008:
    SAA6008_00441
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0441 (lpl7)
    Mu50:
    SAV0443 (lpl7)
    MW2:
    RF122:
    ST398:
    SAPIG0509
    T0131:
    SAT0131_00477 (acs)
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0441 (lpl7)
    VC40:
    SAVC_01810

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            ----------MGYFKRVVLYIIVMVVSVFIIGCNKSSDTSEKPKEDSKETQIKKSFAKTL
    NCTC8325        MKYKTERREAMGYLKRFALYISVMILIFAIAGCGKGNET----KEDSKEEQIKKSFAKTL
    Newman          ---------MMGYLKRLVLYIVIMVMSVFIIGCDKSSDTAEKSKEDSKETQIKKSFAKTL
    USA300_FPR3757  ---------MMGYLKRLVLYIVIMVMSVFIIGCDKSSDTAEKSKEDSKETQIKKSFAKTL
                              ***:**..*** :*:: . * **.*..:*    ****** **********

    N315            DMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRT
    NCTC8325        DMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRT
    Newman          DMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKQGELSNEGMVLYLDRNTRT
    USA300_FPR3757  DMYSIKNLEELYDKEGYRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRT
                    ***.*****:************:****************** * ****************

    N315            AKGHYFVKTFYNKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFGQYANLKE
    NCTC8325        AKGHYFVKTFYNKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKE
    Newman          AKGYYFVRTFYRKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKE
    USA300_FPR3757  AKGYYFVRTFYRKDKLPDRKNYKVEMKNNKIILLDKVEDKKLKQKIENFKFFSQYANLKE
                    ***:***:***.*.*:*********************** :**::*******.*******

    N315            LKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGDLKGSS
    NCTC8325        LKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSS
    Newman          LKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSS
    USA300_FPR3757  LKNYSNGDVSINENVPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSS
                    ****.**************.*:**********************:*********:*****

    N315            VGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDEDDE
    NCTC8325        VGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDEDDE
    Newman          VGDRKLEIDFSKRENSHLSVIDSLDYQPAKTNKDDE
    USA300_FPR3757  VGDRKLEIDFSKRENSHLSVIDSLDYQPAKTNKDDE
                    ** :********  :*.*******::****.::***