From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN002145000
  • symbol?: lpl8
  • description?: putative lipoprotein

      descriptions from strain specific annotations:

    • putative lipoprotein
    • tandem lipoprotein
    • Tandem lipoprotein within Pathogenicity island
    • staphylococcus tandem lipoproteins family protein
    • staphylococcal tandem lipoprotein
  • strand?: +
  • coordinates?: 2649037..2651842
  • synteny block?: BlockID0014510
  • occurrence?: in 63% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0404 (lpl8)
    NCTC8325:
    Newman:
    NWMN_0411 (lpl8nm)
    USA300_FPR3757:
    04-02981:
    SA2981_0420 (lpl8)
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_379
    ED133:
    SAOV_0457
    ED98:
    SAAV_0387
    HO 5096 0412:
    JH1:
    SaurJH1_0479
    JH9:
    SaurJH9_0467
    JKD6008:
    SAA6008_00447 (lpl8_1)
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR0444
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0442 (lpl8)
    Mu50:
    SAV0444 (lpl8)
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_00482
    TCH60:
    HMPREF0772_10078
    TW20:
    SATW20_05130
    USA300_TCH1516:
    USA300HOU_0446
    VC40:
    SAVC_01815

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKSIKRIGLCISLLILIIFVTSCDGDNKIIGDSKEEQIKKSFAKTLDIYPIKNLEDLYDK
    N315            MKSIKRIGLCISLLILIIFATSC-GSNKITGDSKEEQIKKSFAKSLDKYPTENLEEFYDK
    NCTC8325        MKSIKRIGLCISLLILIIFVTSCDGDNKIIGDSKEEQIKKSFAKTLDIYPIKNLEDLYDK
    Newman          MKSIKRIGLCISLLILIIFVTSCDGDNKIIGDSKEEQIKKSFAKTLDIYPIKNLEDLYDK
    USA300_FPR3757  MKSIKRIGLCISLLILIIFVTSCDGDNKIIGDSKEEQIKKSFAKTLDIYPIKNLEDLYDK
                    *******************.*** *.*** **************:** ** :***::***

    COL             EGYRDGEFKKDDKGTWLIRSEMKIQLKGENLESRGAVLEINRNTRTAKGHYIVREVVEDS
    N315            EGYRDGEFEKDDKGTWLIRSEMKIQLKGENLESRGAVIEINRNTRTAKGNYIVREVVEDS
    NCTC8325        EGYRDGEFKKDDKGTWLIRSEMKIQLKGENLESRGAVLEINRNTRTAKGHYIVREVVEDS
    Newman          EGYRDGEFKKDDKGTWLIRSEMKIQLKGENLESRGAVLEINRNTRTAKGHYIVREVVEDS
    USA300_FPR3757  EGYRDGEFKKDDKGTWLIRSEMKIQLKGENLESRGAVLEINRNTRTAKGHYIVREVVEDS
                    ********:****************************:***********:**********

    COL             DGMTHNHTKRYPVKMENNKMIPLKPIDDEKVKKEIEEFNFFVQYGNFKELENYKEDEVSY
    N315            DGMTHNHTKRYPVKMENNKMIPLKSIDDEKVKKEIEEFKFFVQYGNFKELENYKEDEVSY
    NCTC8325        DGMTHNHTKRYPVKMENNKMIPLKPIDDEKVKKEIEEFNFFVQYGNFKELENYKEDEVSY
    Newman          DGMTHNHTKRYPVKMENNKMIPLKPIDDEKVKKEIEEFNFFVQYGNFKELENYKEDEVSY
    USA300_FPR3757  DGMTHNHTKRYPVKMENNKMIPLKPIDDEKVKKEIEEFNFFVQYGNFKELENYKEDEVSY
                    ************************.*************:*********************

    COL             NPEVPIYSAKYQLKNSDYNVEQLRKRYNIPTQKAPKLLLKGSGNLKGSSVGYKNIEFTFI
    N315            NPEVPIYSAQYQLKNSDYNVEQLRKRYNIPTQKAPKLLLKGSGNLKGSSVGYKNIEFTFV
    NCTC8325        NPEVPIYSAKYQLKNSDYNVEQLRKRYNIPTQKAPKLLLKGSGNLKGSSVGYKNIEFTFI
    Newman          NPEVPIYSAKYQLKNSDYNVEQLRKRYNIPTQKAPKLLLKGSGNLKGSSVGYKNIEFTFI
    USA300_FPR3757  NPEVPIYSAKYQLKNSDYNVEQLRKRYNIPTQKAPKLLLKGSGNLKGSSVGYKNIEFTFI
                    *********:*************************************************:

    COL             ENKEENIYFTDSIYFNPSEDK
    N315            ENKEENIYFTDSVYFNPSEDK
    NCTC8325        ENKEENIYFTDSIYFNPSEDK
    Newman          ENKEENIYFTDSIYFNPSEDK
    USA300_FPR3757  ENKEENIYFTDSIYFNPSEDK
                    ************:********