Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002155000
  • symbol?:
  • description?: cobalamin synthesis protein

      descriptions from strain specific annotations:

    • cobalamin synthesis protein
    • cobalamin synthesis protein, P47K
    • cobalamin synthesis protein P47K
    • cobalamin synthesis protein, putative
    • Putative GTPases (G3E family)
    • cobW/HypB/UreG, nucleotide-binding domain protein
    • putative cobalamin synthesis protein
    • cobalamin (vitamin B12) biosynthesis protein
    • YciC protein
    • Low-affinity zinc transport protein
    • putative metal chaperone, GTPase
    • CobW/P47K family protein
  • strand?: +
  • coordinates?: 2665120..2666322
  • synteny block?: BlockID0014590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0417 (cobW)
    USA300_FPR3757:
    04-02981:
    SA2981_0426
    08BA02176:
    C248_0501
    11819-97:
    MS7_0424
    71193:
    ST398NM01_0517
    ECT-R 2:
    ECTR2_385
    ED133:
    SAOV_0466
    ED98:
    SAAV_0394
    HO 5096 0412:
    SAEMRSA15_03750
    JH1:
    SaurJH1_0485
    JH9:
    SaurJH9_0473
    JKD6008:
    SAA6008_00453 (cobW)
    JKD6159:
    SAA6159_00402 (cobW)
    LGA251:
    SARLGA251_03850
    M013:
    M013TW_0413
    MRSA252:
    SAR0450
    MSHR1132:
    SAMSHR1132_03960
    MSSA476:
    SAS0408
    Mu3:
    SAHV_0448
    Mu50:
    SAV0450
    MW2:
    MW0406
    RF122:
    SAB0401
    ST398:
    SAPIG0517
    T0131:
    SAT0131_00488
    TCH60:
    HMPREF0772_10072
    TW20:
    SATW20_05190
    USA300_TCH1516:
    USA300HOU_0452 (cobW1)
    VC40:
    SAVC_01845

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKIPVTVLSGYLGSGKTTLLNHILQNREGRRIAVIVNDMSEVNIDKDLVADGGGLSRTD
    N315            MAKIPVTVLSGYLGSGKTTLLNHILQNREGRRIAVIVNDMSEVNIDKDLVADGGGLSRTD
    NCTC8325        MAKIPVTVLSGYLGSGKTTLLNHILQNREGRRIAVIVNDMSEVNIDKDLVADGGGLSRTD
    Newman          MAKIPVTVLSGYLGSGKTTLLNHILQNREGRRIAVIVNDMSEVNIDKDLVADGGGLSRTD
    USA300_FPR3757  MAKIPVTVLSGYLGSGKTTLLNHILQNREGRRIAVIVNDMSEVNIDKDLVADGGGLSRTD
                    ************************************************************

    COL             EKLVELSNGCICCTLRDDLLKEVERLVKKGGIDQIVIESTGISEPVPVAQTFSYIDDELG
    N315            EKLVELSNGCICCTLRDDLLKEVERLVKKGGIDQIVIESTGISEPVPVAQTFSYIDDELG
    NCTC8325        EKLVELSNGCICCTLRDDLLKEVERLVKKGGIDQIVIESTGISEPVPVAQTFSYIDDELG
    Newman          EKLVELSNGCICCTLRDDLLKEVERLVKKGGIDQIVIESTGISEPVPVAQTFSYIDDELG
    USA300_FPR3757  EKLVELSNGCICCTLRDDLLKEVERLVKKGGIDQIVIESTGISEPVPVAQTFSYIDDELG
                    ************************************************************

    COL             IDLTAICRLDTMVTVVDANRFVHDINSEDLLMDRDQSVDETDERSIADLLIDQVEFCDVL
    N315            IDLTAICRLDTMVTVVDANRFVHDINSEDLLMDRDQSVDETDERSIADLLIDQVEFCDVL
    NCTC8325        IDLTAICRLDTMVTVVDANRFVHDINSEDLLMDRDQSVDETDERSIADLLIDQVEFCDVL
    Newman          IDLTAICRLDTMVTVVDANRFVHDINSEDLLMDRDQSVDETDERSIADLLIDQVEFCDVL
    USA300_FPR3757  IDLTAICRLDTMVTVVDANRFVHDINSEDLLMDRDQSVDETDERSIADLLIDQVEFCDVL
                    ************************************************************

    COL             IINKIDLISEEELAKLEKMLSALQPTAKIIKTTNSEVDLKEVLNTQRFDFEKASESAGWI
    N315            IINKIDLISEEELAKLEKVLSALQPIAKIIKTTNSEVDLKEVLNTQRFDFEKASESAGWI
    NCTC8325        IINKIDLISEEELAKLEKMLSALQPTAKIIKTTNSEVDLKEVLNTQRFDFEKASESAGWI
    Newman          IINKIDLISEEELAKLEKMLSALQPTAKIIKTTNSEVDLKEVLNTQRFDFEKASESAGWI
    USA300_FPR3757  IINKIDLISEEELAKLEKMLSALQPTAKIIKTTNSEVDLKEVLNTQRFDFEKASESAGWI
                    ******************:****** **********************************

    COL             KELESGGHASHTPETEEYGISSFVYKRRLPFHAKRFNDWLESMPNNVVRSKGIVWLAQYN
    N315            KELESGGHASHTPETEEYGISSFVYKRRLPFHAKRFNDWLESMSNNVVRSKGIVWLAQYN
    NCTC8325        KELESGGHASHTPETEEYGISSFVYKRRLPFHAKRFNDWLESMPNNVVRSKGIVWLAQYN
    Newman          KELESGGHASHTPETEEYGISSFVYKRRLPFHAKRFNDWLESMPNNVVRSKGIVWLAQYN
    USA300_FPR3757  KELESGGHASHTPETEEYGISSFVYKRRLPFHAKRFNDWLESMPNNVVRSKGIVWLAQYN
                    *******************************************.****************

    COL             HVACLLSQAGSSCNIHPVTYWVASMSEAQQTQILAERQDVAAEWDPEYGDRHTQFVIIGT
    N315            HVACLLSQAGSSCNIHPVTYWVASMSEAQQTQILAERQDVAAEWDPEYGDRHTQFVIIGT
    NCTC8325        HVACLLSQAGSSCNIHPVTYWVASMSEAQQTQILAERQDVAAEWDPEYGDRHTQFVIIGT
    Newman          HVACLLSQAGSSCNIHPVTYWVASMSEAQQTQILAERQDVAAEWDPEYGDRHTQFVIIGT
    USA300_FPR3757  HVACLLSQAGSSCNIHPVTYWVASMSEAQQTQILAERQDVAAEWDPEYGDRHTQFVIIGT
                    ************************************************************

    COL             ELDEEKLTKELDACLVNAQEIDADWQQFEDPYQWQIRPAR
    N315            ELDEEKLTKELDACLVNAQEIDADWQQFEDPYQWQIRPAR
    NCTC8325        ELDEEKLTKELDACLVNAQEIDADWQQFEDPYQWQIRPAR
    Newman          ELDEEKLTKELDACLVNAQEIDADWQQFEDPYQWQIRPAR
    USA300_FPR3757  ELDEEKLTKELDACLVNAQEIDADWQQFEDPYQWQIRPAR
                    ****************************************